Search results for "servi"

showing 10 items of 4470 documents

How do online communities matter? Comparison between active and non-active participants in an online behavioral weight loss program

2016

This paper contributes to the discussion on the potential of different social media platforms in health behavior change programs. More specifically, it compares the outcomes of participation in different online community platforms in an online behavioral weight loss program. Results show that active participants on online community platforms perceive their service experience more positively, follow instructions more precisely, have a more positive perception of achieving their goals, and also feel that they receive more social support than do those who do not actively participate in online community channels, although no differences were found related to weight loss itself. Furthermore, int…

obesity020205 medical informaticsverkkoyhteisötmedia_common.quotation_subjectsocial mediasosiaalinen mediaterveydenhoito02 engineering and technology03 medical and health sciencesSocial support0302 clinical medicineArts and Humanities (miscellaneous)health behaviorPerceptionHealth care0202 electrical engineering electronic engineering information engineeringSocial media030212 general & internal medicineta518ta315ta512General Psychologymedia_commonOnline participationbusiness.industryBehavior changeService providerOnline communityhealth careonline communitiesHuman-Computer InteractionlihavuusbusinessPsychologySocial psychologyComputers in Human Behavior
researchProduct

WEIGHT-BASED STIGMATIZATION, DISTRESS PSICOLOGICO ED UTILIZZO DEI SERVIZI SANITARI IN SOGGETTI OBESI: UN APPROCCIO MIXED-METHOD

2014

obesità weight-based stigmatizationdistress psicologico uso dei servizi sanitari mixed method
researchProduct

Obiektowy rachunek kosztów usług pasażerskiego transportu samochodowego na przykładzie PKS SA

2018

W dobie silnej konkurencji, dynamicznie zmieniających się warunków rynkowych rachunek kosztów odgrywa ważną rolę, bowiem generuje informacje do podejmowania racjonalnych decyzji. Celem artykułu jest zaprezentowanie możliwości wykorzystania obiektowego rachunku kosztów w działalności usługowej pasażerskiego transportu samochodowego. Zmierzając do osiągnięcia celu, omówiono istotę obiektowego rachunku kosztów oraz korzyści wynikające z jego stosowania. Przedstawiono informacje o spółce – specyfikę przedmiotu działalności, strukturę organizacyjną, bowiem wpływają one na kształt rachunku kosztów. Do rozwiązania przedstawionego problemu badawczego wykorzystano metodę analizy literatury przedmiot…

object-oriented cost accountingtransportation servicesobiektowy rachunek kosztówusługi transportowePrace Naukowe Uniwersytetu Ekonomicznego We Wrocławiu
researchProduct

Recensione di D. Roth, Revocatio in servitutem. DDie rechtliche Beständigkeit der Freilassung vor dem Hintergrund der actio ingrati. Europäische Hoch…

2020

obsequium.Settore IUS/18 - Diritto Romano E Diritti Dell'Antichita'ingratitudinerevocatio in servitutemStatus dei liberti
researchProduct

Monialaisen ohjauksen rakentuminen ohjaustilanteissa: onko monialainen ohjaus monialaista?

2022

Monialaisia ohjauspalveluita perustellaan niiden myönteisillä vaikutuksilla asiakkaisiin, työntekijöihin ja mukana oleviin palveluntuottajiin, mutta monialaista ohjausta koskeva empiirinen ja teoreettinen tutkimusnäyttö on toistaiseksi vähäistä. Tarkastelemme artikkelissamme sitä, miten eri tavoin monialaista ohjausta toteutetaan toiminnan tasolla. Aineiston muodostaa vuosina 2018–2019 kerätty havainnointiaineisto nuorten ohjaus- ja neuvontapalveluja tuottavan Ohjaamon ohjaustilanteista (n = 68). Kysymme, millaisiin erilaisiin tekoihin monialainen ohjaus jäsentyy ohjauksen työmuodon ja ammatillisten toimintatapojen perusteella, joita olivat ohjaajien lukumäärä, ohjauksen tavoite, ohjauksen …

ohjauksen ammatilliset toimintatavatopinto-ohjausammatinvalinnanohjauscounselling methodsmoniammatillisuusnon-participatory observationmonialaisuusmonialainen ohjauspalvelutyötavatohjauksen työmuodotohjaajat (kasvatus ja opastus)monialainen ohjausArtikkeleitaohjaus (neuvonta ja opastus)transdisciplinary counselling transdisciplinary guidance serviceei-osallistuva havainnointiprofessional practices of counsellingKasvatus
researchProduct

A Dynamic Life-cycle Model for the Provisioning of Software Testing Services: Experiences from A Case Study in the Chinese ICT Sourcing Market

2011

ICT-enabled international sourcing of software-intensive systems and services (eSourcing) is a powerful strategy for managing businesses more effectively. China is becoming a superpower for eSourcing service provisioning, but most Chinese providers are small or medium-sized and leverage the mediated eSourcing model, delivering services to foreign ICT clients that interface with end-clients onshore. This model restricts the providers to low-value projects. This paper probes eSourcing of software testing services within the Chinese market. Testing is studied for two reasons. First, testing is one of the best ICT services, small- and medium-sized providers can provide to develop domain and tec…

ohjelmistojen testaustestauspalveluiden toimittaminensoftware testing service provisioninginternational esourcingtestauspalveluiden hankkiminen
researchProduct

“They're always in a hurry” : Older people's perceptions of access and recognition in health and social care services

2019

The article examines older people's perceptions of quality of life from the perspective of access and use of health and social care services. The data include focus group discussions with older people living alone. The data were analysed using thematic analysis focusing on the older people's collective views on health and social care services as supportive or restrictive factors for their quality of life. Two central themes were present in all the focus group discussions: the importance of accessing services and information regarding the services, and need for recognition within the services/by the professionals. Both themes were connected to the older people's desire to maintain autonomy i…

older peopleterveyspalvelutsosiaalipalvelutsaavutettavuustiedonsaantiaccess to serviceselämänlaatuikääntyneettunnistaminen
researchProduct

Modelling centralized self-archiving process in Finland

2016

Poster in Repository Fringe conference, Edinburgh, 1.8.2016

open accessUniversity of Jyväskyläself-archivingservice modelFinlandUniversity of Eastern Finland
researchProduct

Boosting for green open access Why, Who and How?

2016

Presentation in Oulu OpenCon seminar, Oulu, 7.12.2016

open accessopen science servicesself-archivingopen sciencepublication forum
researchProduct

From treatment of mental disorders to the treatment of difficult life situations: A hypothesis and rationale

2023

The group-level symptom-reduction model of mental health care emphasizes predetermined treatment guidelines for those mental and social difficulties that are diagnosable as mental health disorders on the basis of predetermined diagnostic criteria. The model have produced generalizable information to support medical decision-making for symptom reduction. However, it may have also increased the reification of diagnostic labels, and in so doing medicalized and stigmatized complex human-life experiences, with a lack of attention to a range of social determinants and existential factors associated with mental health. Since symptom-reduction model can easily lose sight of essential non-technical …

open dialoguepsychiatric servicesGeneral Medicinepsychiatryelämäntilannemielenterveyspsykiatrinen hoitomielenterveyshäiriöthoitomenetelmätvaikeudetontologymielenterveyspalvelutmental healthsosioekonomiset tekijätMedical Hypotheses
researchProduct