Search results for "ski"

showing 10 items of 9488 documents

Toxic microalgae and global change : why have proliferations increased along the Mediterranean coast?

2021

The ocean and the continent converge in a very narrow line that is, nonetheless, truly relevant to the health, leisure, and economy of our society. The Mediterranean coastline has undergone major changes over the last fifty years, which is evident in the alteration of its microalgae species. The proliferation of dinoflagellates is now common in microscopic organism communities in this ecosystem as a result of the modifications caused by humans and climate change. The increased frequency with which toxic microalgae blooms are detected has been key to raising awareness of this change.

sense organsskin and connective tissue diseases
researchProduct

The necessary skills in higher education: Validation of competences

2012

This paper tries to show which competences have an impact on the success of students in higher education and especially in the first academic year. This situation also requires finding a way to acquire the competences which are necessary in this new experience that is the first year. A student is considered to be a person who has the basic competences required. Our role is to show how this person in higher education can acquire the other new competences that help him/her attain the positive results that we name ''success''. Normally, the higher education is a new experience because he/she has never been in these situations before. To reach this goal we will first demonstrate a method to con…

MeasurementRéussite universitaire[SHS.EDU]Humanities and Social Sciences/Education[SHS.EDU] Humanities and Social Sciences/EducationSkills TrainingÉtudiant[ SHS.EDU ] Humanities and Social Sciences/EducationHigher EducationCompétenceEnseignement supérieurMesureSkillAcquisition de compétencesStudentsUniversity Success
researchProduct

Selective favorskii rearrangement in macrocyclic rings

1981

Abstract A mixture of 2,2-dibromo-12-chlorocyclododecanone (IIa) and 2,12-dibromo-2-chlorocyclododecanone (IIb) by Favorskii rearrangement gave selectively methyl 2-chloro-1-cycloundecene-1-carboxylate (IIIa).

ChemistryStereochemistryOrganic ChemistryDrug DiscoveryFavorskii rearrangementBiochemistryTetrahedron Letters
researchProduct

Defects in yttrium aluminium perovskite and garnet crystals: atomistic study

2000

Native and impurity point defects in both yttrium aluminium perovskite (YAP) and garnet (YAG) crystals are studied in the framework of the pair-potential approximation coupled with the shell model description of the lattice ions. The calculated formation energies for native defects suggest that the antisite disorder is preferred over the Frenkel and Schottky-like disorder in both YAP and YAG. The calculated values of the distortion caused by the antisite YAl x in the lattice turn out to be in an excellent agreement with the EXAFS measurements. In non-stoichiometric compounds, the calculated reaction energies indicate that excess Y2 O3 or Al2 O3 is most likely to be accommodated by the forma…

Aluminium oxidesCrystallographyMaterials scienceExtended X-ray absorption fine structureImpurityYttrium aluminiumLattice (order)MineralogyGeneral Materials ScienceCondensed Matter PhysicsCrystallographic defectPerovskite (structure)IonJournal of Physics: Condensed Matter
researchProduct

Perovskite Light-Emitting Devices - Fundamentals and Working Principles

2018

Materials scienceEngineering physicsPerovskite (structure)
researchProduct

Clinical conditions responsible for hyperviscosity and skin ulcers complications

2017

In this brief review, we have examined some clinical conditions that result to be associated to an altered hemorheological profile and at times accompanied by skin ulcers. This skin condition may be observed in patients with the following condtions, such as primary polycythemic hyperviscosity (polycythemia, thrombocytemia) treated with hydroxyurea, primary plasma hyperviscosity (multiple myeloma, cryoglobulinemia, cryofibrinogenemia, dysfibrinogenemia, and connective tissue diseases), primary sclerocythemic hyperviscosity (hereditary spherocytosis, thalassemia, and sickle cell disease). In addition, it may be present in patients with secondary hyperviscosity conditions such as diabetes mell…

medicine.medical_specialtyPhysiologyChronic venous insufficiencyBlood viscosityHyperviscosity syndromeCryofibrinogenemiaHyperviscosity030204 cardiovascular system & hematologyGastroenterologyHyperviscosity syndrome; blood viscosity; skin ulcers030207 dermatology & venereal diseases03 medical and health sciences0302 clinical medicineskin ulcershemic and lymphatic diseasesPhysiology (medical)Internal medicineHyperviscosity syndromeSkin UlcermedicineHumansbusiness.industryHematologyCritical limb ischemiaSkin ulcermedicine.diseaseCryoglobulinemiablood viscositymedicine.symptomCardiology and Cardiovascular Medicinebusiness
researchProduct

Minimal clinically important difference and minimal detectable change of the World Health Organization Disability Assessment Schedule 2.0 (WHODAS 2.0…

2020

Objectives: The aim of this study is to estimate a minimal clinically important difference (MCID) and a minimal detectable change (MDC) of the 12-item WHODAS 2.0 amongst patients with chronic musculoskeletal pain. Design: Cross-sectional cohort study. Setting: Outpatient Physical and Rehabilitation Medicine clinic. Subjects: A total of 1988 consecutive patients with musculoskeletal pain. Interventions: A distribution-based approach was employed to estimate a minimal clinically important difference, a minimal detectable change, and a minimal detectable percent change (MDC%). Results: The mean age of the patients was 48 years, and 65% were women. The average intensity of pain was 6,3 (2.0) po…

MaleMusculoskeletal painSchedule2019-20 coronavirus outbreakmedicine.medical_specialtyCoronavirus disease 2019 (COVID-19)Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)WHODASPhysical Therapy Sports Therapy and Rehabilitationminimal detectable changetuki- ja liikuntaelimetWorld healthDisability assessmentCohort StudiesDisability EvaluationMusculoskeletal PainHumansMedicineskin and connective tissue diseasesmusculoskeletal painPain Measurementbusiness.industryMinimal clinically important differenceminimal clinically important differenceRehabilitationkipuMiddle AgedCross-Sectional StudiesPhysical therapyFemalesense organsWhodasChronic PainbusinessData Collection toolsClinical Rehabilitation
researchProduct

Education, Work and Life

2018

In this chapter, I will study the relationship between education and working life from a few viewpoints. First, I will examine how everyday working life has changed and how education has to change. Second, I will depict how the practices of both education and the working world can and should be researched in terms of the theory of practice architectures. Third, I will come back to reflect on the relationships between work, education and life. The work that people do has increasingly been immaterialized. Working life has been detached from material production which is more and more automated and robotically driven. According to a Swiss professor Schwab (2015, 2016), we have already moved int…

PrecariateducationPractice theorybusiness.industry05 social sciencesIndoctrination050301 educationInformal learningPublic relationstyöSolidarityGlobalizationWork (electrical)koulutus0502 economics and businessCognitive skillSociologyelämäbusiness0503 education050203 business & management
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Commentary: Long-term Practice with Domain-Specific Task Constraints Influences Perceptual Skills.

2018

small-sided gamesfootballskill acquisitionlcsh:BF1-990050105 experimental psychologyfutsalSkill transferDomain (software engineering)Task (project management)Dreyfus model of skill acquisition03 medical and health sciences0302 clinical medicinePerceptual learningtalent development/dk/atira/pure/subjectarea/asjc/3200Small sided gamesPsychology0501 psychology and cognitive sciencesPsychology(all)General PsychologyGeneral Commentary05 social sciencestalentC640030229 sport sciencessoccerTerm (time)Talent developmentrepresentative designlcsh:PsychologyconstraintsPsychologytransferCognitive psychologyFrontiers in psychology
researchProduct