Search results for "soveltaminen"

showing 7 items of 7 documents

Mathematical Fuzzy Logic in the Emerging Fields of Engineering, Finance, and Computer Sciences

2022

With more than 50 years of literature, fuzzy logic has gradually progressed from an emerging field to a developed research domain, incorporating the sub-domain of mathematical fuzzy logic (MFL) [...]

Algebra and Number TheorymatematiikkaLogicsyväoppiminentietojenkäsittelytieteetpääkirjoituksettekoälylaskennallinen tiederahoitusalateknologiaGeometry and Topologysoveltaminenongelmanratkaisusumea logiikkaMathematical PhysicsAnalysis
researchProduct

A Systematic Way of Structuring Real-World Multiobjective Optimization Problems

2023

In recent decades, the benefits of applying multiobjective optimization (MOO) methods in real-world applications have rapidly increased. The MOO literature mostly focuses on problem-solving, typically assuming the problem has already been correctly formulated. The necessity of verifying the MOO problem and the potential impacts of having an incorrect problem formulation on the optimization results are not emphasized enough in the literature. However, verification is crucial since the optimization results will not be meaningful without an accurate problem formulation, not to mention the resources spent in the optimization process being wasted. In this paper, we focus on the MOO problem struc…

identifying objectivesstakeholder interviewsproblem structuringsovellukset (soveltaminen)eliciting expert knowledgepäätöksentekoMOO problem formulationongelmanratkaisusidosryhmätmonitavoiteoptimointidecision making
researchProduct

Perustoimeentulotuen asumismenot kymmenen suurimman kaupungin toimeentulotuen soveltamisohjeissa vuonna 2008

2009

kaupungitsosiaalietuudetasuminenasumistukitoimeentulotukisoveltaminenkustannukset
researchProduct

Koulutuksen siirtovaikutus päivähoitoyksiköiden johtajien koulutuksen käyneiden työtoiminnassa

2001

koulutustransfer of trainingsoveltaminentransferenssisiirtovaikutusvaikuttavuushenkilöstökoulutus
researchProduct

Digitaalinen murros kunnan palveluissa : huomioidaanko kuntalainen hyvinvoinnin toimijana?

2021

tekniikka (laitteet)sovellukset (soveltaminen)osaaminenhyvinvointitoimijuuskuntalaisetdigitalisaatiojulkiset palvelut
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

Kykeneekö viherala hyödyntämään tieteellistä tietoa?

2023

Viherala on merkittävä ja kasvava toimiala. Ilmastonmuutos ja lajien monimuotoisuuden suojelu lisäävät entisestään viheralan painoarvoa. Viheralan kehittäminen edellyttää monipuolista tieteellistä tutkimusta ja kykyä soveltaa uutta tietoa luovasti. Tutkimusta tehdään huomattavan paljon mutta sen vaikuttavuudesta tiedämme suhteellisen vähän. Tämä näkyi myös kevään 2023 Viherpäivien teemassa: Viisas, älykäs, vihreä – muuttuuko tieto teoiksi? Tässä artikkelissa filosofi, professori emeritus Antti Hautamäki selventää, mitä tieteellinen tutkimus on ja miten sitä voidaan soveltaa viheralalla. nonPeerReviewed

tutkimustietotieteellinen tietoympäristönsuojelusoveltaminenviheralailmastonmuutoksetluonnon monimuotoisuus
researchProduct