Search results for "synteesi"

showing 10 items of 132 documents

Strategies for Exploring Functions from Dynamic Combinatorial Libraries

2020

Dynamic combinatorial chemistry (DCC) is a powerful approach for creating complex chemical systems, giving access to the studies of complexity and exploration of functionality in synthetic systems. However, compared with more advanced living systems, the man‐made chemical systems are still less functional, due to their limited complexity and insufficient kinetic control. Here we start by introducing strategies to enrich the complexity of dynamic combinatorial libraries (DCLs) for exploiting unexpected functions by increasing the species of building blocks and/or templates used. Then, we discuss how dynamic isomerization of photo‐switchable molecules help DCLs increase and alter the systemic…

dynamic combinatorial chemistrynoncovalent interactionskemiallinen synteesisupramolekulaarinen kemiakinetic controlchemical complexitykompleksisuussupramolecular chemistry
researchProduct

Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

2020

 Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

filosofitkapitalismimetafysiikkatietotekniikkainformaatiokoneetkulttuurifilosofiayhteiskuntafilosofialuovuusteknologiaDeleuze GillessynteesiLektiotGuattari FélixmateriaalisuusAjatus
researchProduct

Synthesis, structure and photophysical properties of a highly luminescent terpyridine-diphenylacetylene hybrid fluorophore and its metal complexes

2015

A new fluorescent terpyridyl-diphenylacetylene hybrid fluorophore 4′-[4-{(4-methoxyphenyl)ethynyl}phenyl]-2,2′:6′,2′′-terpyridine, L, was synthesized via Sonogashira cross-coupling of 4′-(4-bromophenyl)-2,2′:6′,2′′-terpyridine and 4-ethynylanisole in the presence of Pd(PPh3)4/CuI as a catalyst. The solid state structure of L shows a trans arrangement of pyridine nitrogen atoms along the interannular bond in the terpyridine domain. Five transition metal complexes of L, {[FeL2](CF3SO3)2 (1), [ZnL2](ClO4)2 (2), [CdL2](ClO4)2 (3), [RuL2](PF6)2 (4), and PtMe3IL (5)}, have also been synthesized and characterized by spectroscopic methods and single crystal X-ray analysis. The X-ray crystal structu…

fluorophorecrystal structuresfluoroforitterpyridiinivalofysikaaliset ominaisuudetmetal complexessynteesiterpyridinevalmistusmetallikompleksitphotophysical propertieskiderakenteet
researchProduct

Aromaattiset amidifoldameerit

2015

Pro gradu -tutkielman kirjallinen osa keskittyy aromaattisiin, amidisidoksellisiin foldameereihin ja erityisesti amidi-, imidi- ja hydratsidifoldameereihin. Synteesien ja menetelmien sijaan osuudessa on paneuduttu foldameerien laskostumiseen vaikuttaviin tekijöihin, kuten vetysidoksiin, kiraaliseen induktioon ja kompleksoitumiseen. Tämän lisäksi myös foldameerien solubiologista vuorovaikutusta on tuotu esiin. Kokeellinen osa keskittyy kahden aromaattisen amidifoldameerin synteeseihin ja niistä saatujen tuotteiden kiteyttämisiin ja kiderakenteisiin. Foldameerit laskostuivat testatuissa, polaarisissa liuottimissa ja muodostivat sekä intramolekulaarisia että intermolekulaarisia vetysidoksia. L…

foldameerisynteesi
researchProduct

The role of oxidation treatments before and after CVD synthesis of graphene on copper catalytic surface

2021

Graphene is a sheet of honeycomb bonded carbon, that is only one atom thick. Aside from its remarkable strength, graphene has great conducting and photochemical prop erties. Due to its unique properties, it can be used as viable option for rare metals in circuits and in new type of measuring components. To express these properties at their best, graphene should be single crystal and as clean as possible. In this bachelor thesis, different treatment options for catalytic metal surface for graphene synthesis are studied in chemical vapor deposition growth. Different options to treat the catalytic metal layer were studied, such as changes in gas compositions in annealing process, electropolish…

hiilidioksidihapetuskemiallinen synteesigraphenecarbon dioxidecleaningpuhdistuskuparisurface treatmentpintakäsittelynanorakenteetthin filmsoxidation (active)coppernanostructuresgrafeeniohutkalvotchemical synthesis
researchProduct

Hopeananoklusterien synteesit, stabiilisuus ja monodispersiivisyys

2014

Tämän pro gradun kirjallisuusosassa tarkastellaan hopeananoklustereiden synteesejä. Tarkastelussa keskitytään erityisesti hopeaklustereiden stabiilisuuteen ja monodispersiivisyyteen. Hopeaklustereiden synteesimenetelmät on jaoteltu liuoksessa tehtyihin synteeseihin, kiinteässä olomuodossa tehtyihin synteeseihin ja templaattisynteeseihin. Lisäksi tarkastellaan hopean seosklustereiden synteesejä. Työn lopussa on lyhyet katsaukset klustereiden stabiilisuuteen vaikuttavista tekijöistä ja klustereiden karakterisoitimenetelmistä. Kokeellisen osan tarkoituksena oli syntetisoida hopeaklustereita käyttäen ligandina C5-tetrametoksiresorsinareeni-bis-tiakruunua ja muita resorsinareenipohjaisia molekyy…

hopeananoklusteritmonodispersiivisyysklusteritstabiiliushopeastabilointi (kemia)nanohiukkasetsynteesi
researchProduct

Efficient Consecutive Synthesis of Ethyl-2-(4-Aminophenoxy) Acetate, a Precursor for Dual GK and PPARγ Activators, X-ray Structure, Hirshfeld Analysi…

2022

Herein, we report a facile synthesis of ethyl-2-(4-aminophenoxy)acetate 4 as a building synthon for novel dual hypoglycemic agents. This building template was synthesized by alkylation of 4-nitrophenol with ethyl bromo-acetate followed by selective reduction of the nitro group. This reduction methoddoes not require nascent hydrogen or any reaction complexity; it goes easily via consecutive reaction in NH4Cl/Fe to yield our target synthon as very pure crystals. This product was characterized by 1HNMR, 13CNMR, COSY, NOESY NMR spectroscopy, and elemental analysis. Additionally, its structure was studied and approved by X-ray single crystal structure determination. The unit cell parameters are …

hypoglycemicX-raykemiallinen synteesiconsecutive reactionbioaktiiviset yhdisteettiheysfunktionaaliteoriaglukoosiaineenvaihduntaaminophenoxyHirshfeld analysisheterosykliset yhdisteetröntgenkristallografia
researchProduct

Iodination of antipyrine with [N–I–N]+ and carbonyl hypoiodite iodine(i) complexes

2023

A series of iodine(I) complexes, both known and new, were synthesised and the dependence of iodination reactivity on the identity of the Lewis bases and anions present was investigated. Using a previously established screening protocol based on the iodination of antipyrine to iodo-antipyrine, the capability of the iodine(I) species to perform the iodination was tested and compared, especially in relation to Barluenga's reagent, [I(pyridine)2]BF4. The results indicated that the identity of both the Lewis bases and the anion influence the iodination capability of the iodine(I) species, and that the less efficient reagents can deliver favourably comparable percentage conversions with longer re…

jodikemiallinen synteesikompleksiyhdisteetkarbonyylit
researchProduct

Trans-(2,5)-disubstituoitujen pyrrolidiiniyhdisteiden enantioselektiivinen synteesi

2018

2,5-disubstituoitujen pyrrolidiinien enantioselektiivistä synteesiä on tutkittu paljon, sillä pyrrolidiinirakenne löytyy monista alkaloideista ja on täten tärkeä osa luonnonainesynteesiä. Lisäksi ne toimivat tärkeinä asymmetrisen synteesin työkaluina. Erityisen kiinnostavia tässä suhteessa ovat erilaiset trans-2,5-bisaryylipyrrolidiinit katalyyttisten ominaisuuksiensa vuoksi. Tässä tutkielmassa käydään läpi eräitä tapoja niiden syntetisoimiseksi. Tutkielmassa keskitytään erityisesti trans-2,5-difenyylipyrrolidiinin enantioselektiiviseen synteesiin.

katalyytitamiinitorgaaninen kemiapyrrolidiinisynteesienantioselektiivisyys
researchProduct

Stereoselective Synthesis of Spiro-Decalin Oxindole Derivatives via Sequential Organocatalytic Michael-Domino Michael/Aldol Reaction.

2022

A highly stereoselective procedure for the synthesis of spiro-polycyclic oxindoles bearing five contiguous stereogenic centers including two tetrasubstituted carbons has been developed. Under sequential organocatalysis performed by a pyrrolidine-based organocatalyst and DBU, a highly atom-economical Michael–domino Michael/aldol reaction sequence was optimized, yielding variously functionalized spiro-decalin oxindoles with excellent stereoselectivity (>99:1 dr, up to 92% ee). peerReviewed

kemiallinen synteesiAldehydesMolecular StructureOrganic Chemistryasymmetric organocatalysisdomino reactionssprio heterocyclesStereoisomerismNaphthalenesCatalysisOxindolesorgaaninen kemiaSpiro Compoundsasymmetric organocatalysis; oxindoles; sprio heterocycles; domino reactionsThe Journal of organic chemistry
researchProduct