Search results for "telemedicine."

showing 10 items of 172 documents

Access to eHealth language-based services for multinational patients

2015

In more and more countries the number of citizens with double nationality is growing substantially. In their developing stage, current eHealth technologies are oriented towards helping the native patients rather than those speaking a foreign language that limits an access to the medical care. Nowadays, most people search the web for the medical symptoms of their disorders before going to the General Practitioner (GP), however multinational patients have limited chance to access eHealth care services not only owning to the lack of medical knowledge, but specifically due to their language barriers. In this study we investigate eHealth services on multilingual information access and online com…

Medical educationTelemedicinebusiness.industryeducationForeign languageInformation accessLanguage barriereHealth servicesinformation systemsHealth informaticsNursingMultinational corporationeHealthInformation systemmedical informaticsMedicinetelemedicinebusinesshealth care economics and organizationscommunication technologies2015 17th International Conference on E-health Networking, Application & Services (HealthCom)
researchProduct

A Digital Watermarking Algorithm Based on DCT: Application on Medical Image

2012

International audience; This work is a presentation of a new approach of robust watermarking applied in medical domain such as telemedicine hence the need to keep the visual aspect of medical images and other conservation of the various data substituted. For hiding information, the proposed method uses the Discrete Cosine Transform (DCT) space. To control identification and eventually the correction (if possible) of the data inserted, it should be noted that we used the series turbocode to recover the data inserted and after application of several attacks.

Medical image[INFO.INFO-TI] Computer Science [cs]/Image Processing [eess.IV]Telemedicine.[INFO.INFO-TI]Computer Science [cs]/Image Processing [eess.IV]SHA-1[ INFO.INFO-TI ] Computer Science [cs]/Image Processingserial turbocodeTelemedicineDiscrete Cosine Transform
researchProduct

How to enhance digital support for cross-organisational health care teams? A user-based explorative study

2020

Health care service provision of individualised treatment to an ageing population prone to chronic conditions and multimorbidities is threatened. There is a need for digitally supported care, that is, (1) person-centred, (2) integrated, and (3) proactive. The research project 3P, Patients and Professionals in Productive Teams, aimed to validate and verify the prerequisites for health care systems run with patient-centred service models. This paper presents an explorative study of the digital support of a cross-organisational health care team in Norway, providing services to elderly frail people with multimorbidities in hospital discharge transition. Qualitative research methods were employe…

Medicine (General)Population ageingService (systems architecture)Knowledge management020205 medical informaticsArticle SubjectHealth Services for the AgedFrail Elderlymedia_common.quotation_subjectInteroperabilityBiomedical EngineeringHealth InformaticsCloud computingComorbidity02 engineering and technology03 medical and health sciencesR5-9200302 clinical medicineVDP::Teknologi: 500::Medisinsk teknologi: 620Patient-Centered CareHealth careMedical technology0202 electrical engineering electronic engineering information engineeringHumans030212 general & internal medicineInformation flow (information theory)R855-855.5VDP::Teknologi: 500::Informasjons- og kommunikasjonsteknologi: 550Qualitative ResearchAgedmedia_commonPatient Care TeamTeamworkComputersNorwaybusiness.industryData CollectionVDP::Medical disciplines: 700::Health sciences: 800Cloud ComputingTelemedicineVDP::Medisinske Fag: 700::Helsefag: 800Models OrganizationalChronic DiseaseSurgerybusinessVDP::Technology: 500::Medical technology: 620Research ArticleBiotechnologyQualitative research
researchProduct

Psychological support and psychotherapy via digital devices in Covid-19 emergency time: Some critical issues

2020

The Covid-19 pandemic and the resulting fear, quarantine and lockdown measures implemented in Italy and other countries to contain the risk of contagion have seriously impacted the mental health of a large number of people. The need to offer psychological and psychotherapeutic support to these people, while respecting the government’s pressing calls to “stay home”, have led many psychologists and psychotherapists, both in the public and private sectors, to provide their professional services via teleconference, telephone, smartphone, etc. The aim of this work is to highlight some critical issues related to the sudden switch from the traditional method of providing psychological services to…

Mental Health ServicesTelemedicine020205 medical informaticsPneumonia Viral02 engineering and technologye-psychological careprivacyBetacoronavirus03 medical and health sciences0302 clinical medicineInformed consent0202 electrical engineering electronic engineering information engineeringprofessional responsibilityHumansConfidentiality030212 general & internal medicinePandemicsComputer SecurityGovernmentcriticismSARS-CoV-2business.industryinformed consentTeleconferenceGeneral MedicinePublic relationsPrivate sectorProfessional responsibilityMental healthTelemedicineItalyQuarantinePsychologybusinessCovid-19Coronavirus InfectionsConfidentiality
researchProduct

Digitalized transcranial electrical stimulation: A consensus statement.

2022

Objective: Although relatively costly and non-scalable, non-invasive neuromodulation interventions are treatment alternatives for neuropsychiatric disorders. The recent developments of highly-deployable transcranial electric stimulation (tES) systems, combined with mobile-Health technologies, could be incorporated in digital trials to overcome methodological barriers and increase equity of access. The study aims are to discuss the implementation of tES digital trials by performing a systematic scoping review and strategic process mapping, evaluate methodological aspects of tES digital trial designs, and provide Delphi-based recommendations for implementing digital trials using tES.Methods: …

Mobile HealthConsensusSettore M-PSI/02 - PSICOBIOLOGIA E PSICOLOGIA FISIOLOGICAClinical psychologymethods [Transcranial Direct Current Stimulation]Transcranial Direct Current StimulationSensory SystemsElectric StimulationTelemedicinePsychiatry and Mental healthNeurologyPhysiology (medical)Delphi panelSystematic reviewHumansNon-invasive neuromodulationNeurology (clinical)ddc:610Digital healthClinical neurophysiology : official journal of the International Federation of Clinical Neurophysiology
researchProduct

Telemedicine and mobile health with integrative medicine in developing countries

2014

International audience; African Home-based Care (AHC) and African Traditional Medicine (ATM) provide a number of self-sustainable primary health care workers in a rural region with the appreciation of ancestral knowledge and its contextual management. Even though most urban residents are able to afford and use conventional medicine to large extent, the implementations of modern medicine in rural areas and in poor peri-urban areas are limited. Our proposal is on how telemedicine solutions could enhance AHC and ATM practices and facilitate simultaneous delivery of both modern and traditional healthcare with evident added value to the recipients. This is indeed a fresh angle, as information an…

Modern medicineTelemedicine020205 medical informaticsBiomedical EngineeringMédecine humaine et pathologieDeveloping country02 engineering and technology03 medical and health sciences0302 clinical medicineNursing[ SDV.MHEP ] Life Sciences [q-bio]/Human health and pathologyHealth care0202 electrical engineering electronic engineering information engineeringAdded valueMedicineMobile health030212 general & internal medicineComplementary healthcarebusiness.industryHealth Policy1. No povertyCollaborative knowledge buildingPublic relationsTelemedicine3. Good healthInformation and Communications TechnologyIntegrative medicineRural areaIntegrated medicinebusiness[SDV.MHEP]Life Sciences [q-bio]/Human health and pathologyHealth Policy and Technology
researchProduct

Expectations, experiences and attitudes of patients and primary care health professionals regarding online psychotherapeutic interventions for depres…

2013

Abstract Background In the year 2020, depression will cause the second highest amount of disability worldwide. One quarter of the population will suffer from depression symptoms at some point in their lives. Mental health services in Western countries are overburdened. Therefore, cost-effective interventions that do not involve mental health services, such as online psychotherapy programs, have been proposed. These programs demonstrate satisfactory outcomes, but the completion rate for patients is low. Health professionals’ attitudes towards this type of psychotherapy are more negative than the attitudes of depressed patients themselves. The aim of this study is to describe the profile of d…

Médicos de atención primariaPsychological interventionActitud ante los ordenadoresActitud ante la salud:Psychiatry and Psychology::Behavior and Behavior Mechanisms::Attitude::Attitude to Computers [Medical Subject Headings]:Organisms::Eukaryota::Animals::Chordata::Vertebrates::Mammals::Primates::Haplorhini::Catarrhini::Hominidae::Humans [Medical Subject Headings]DepresionStudy ProtocolCompletion rateProtocol:Health Care::Health Care Quality Access and Evaluation::Delivery of Health Care::Attitude to Health [Medical Subject Headings]Depression (differential diagnoses)Qualitative Researcheducation.field_of_studyOnline psychotherapyEntrevistas como asuntoAttitude to ComputersDepressionGrupos focales:Health Care::Health Care Quality Access and Evaluation::Delivery of Health Care::Attitude of Health Personnel [Medical Subject Headings]TelemedicinaFocus GroupsTelemedicinePsychiatry and Mental health:Health Care::Health Services Administration::Patient Care Management::Delivery of Health Care::Telemedicine [Medical Subject Headings]Attitude to Healthmedicine.medical_specialtyTelemedicineAttitude of Health Personnel:Psychiatry and Psychology::Behavioral Disciplines and Activities::Psychotherapy [Medical Subject Headings]PopulationInternet-based treatmentPhysicians Primary CareInterviews as TopicActitud del personal sanitariomedicineHumansPsychiatryeducationbusiness.industry:Analytical Diagnostic and Therapeutic Techniques and Equipment::Investigative Techniques::Epidemiologic Methods::Data Collection::Interviews as Topic::Focus Groups [Medical Subject Headings]:Analytical Diagnostic and Therapeutic Techniques and Equipment::Investigative Techniques::Epidemiologic Methods::Data Collection::Interviews as Topic [Medical Subject Headings]:Health Care::Health Care Facilities Manpower and Services::Health Personnel::Physicians::Physicians Primary Care [Medical Subject Headings]:Disciplines and Occupations::Natural Science Disciplines::Science::Research::Empirical Research::Qualitative Research [Medical Subject Headings]Mental healthFocus groupPsychotherapyQualitative study:Psychiatry and Psychology::Behavior and Behavior Mechanisms::Behavior::Behavioral Symptoms::Depression [Medical Subject Headings]businessQualitative research
researchProduct

Beyond the lessons learned from the COVID-19 pandemic: opportunities to optimize clinical trial implementation in oncology.

2021

Abstract The COVID-19 pandemic affected millions of people globally with lasting effects on society, patients, investigators and health institutions. Clinical trials, our best tool to improve cancer treatment for patients through testing the clinical value of a new treatment, have been affected by the pandemic. The pandemic footprint represents both a risk of compromising development of new therapies and an opportunity to elicit discussion over a portfolio of broader reforms, applicable irrespective of pandemics, in order to improve the design and implementation of clinical trials in oncology. The administrative load should be reduced, without affecting the quality of research and principle…

OncologyCancer ResearchTelemedicinemedicine.medical_specialtyOncologiamedia_common.quotation_subjectMedical Oncology:profesiones sanitarias::medicina::medicina interna::oncología médica [DISCIPLINAS Y OCUPACIONES]Quality of life (healthcare):características del estudio::estudio clínico::ensayo clínico [CARACTERÍSTICAS DE PUBLICACIONES]:Study Characteristics::Clinical Study::Clinical Trial [PUBLICATION CHARACTERISTICS]Internal medicinePandemic:virosis::infecciones por virus ARN::infecciones por Nidovirales::infecciones por Coronaviridae::infecciones por Coronavirus [ENFERMEDADES]medicinePandèmia de COVID-19 2020-HumansQuality (business):Health Occupations::Medicine::Internal Medicine::Medical Oncology [DISCIPLINES AND OCCUPATIONS]Pandemicsmedia_commonCOVID-19; Humans; Medical Oncology; Pandemics/prevention & control; SARS-CoV-2; TelemedicineSurrogate endpointSARS-CoV-2COVID-19:Virus Diseases::RNA Virus Infections::Nidovirales Infections::Coronaviridae Infections::Coronavirus Infections [DISEASES]World populationTelemedicineClinical trialEditorialOncologyGood clinical practiceBusinessAssaigs clínicsESMO open
researchProduct

Integrating Telemedicine Solutions with Electronic Health Records; Evaluation of Alternatives based on the Proposed Reference Architecture for Norway…

2016

This report studies the way forward for how a telemedicine solution can be integrated for exchange of data with an existing Electronic Health Record (EHR) system. The solution used an example for this report is based on a telemedicine solution for COPD patients (Chronic Obstructive Pulmonary Disease) developed in the project “Collaborative Point-of-Care Services Agder: Follow-up of COPD patients as part of the United4Health EU Project», with financial support from the Research Council of Norway. In addition, the EHR solution from DIPS ASA is used as an example of an existing system for integration. Important parameters for choosing way forward on how to are:  urgency with regards to timeli…

OpenEHRVDP::Teknologi: 500::Medisinsk teknologi: 620FHIREHR integrationArchetypesXDSVDP::Teknologi: 500::Informasjons- og kommunikasjonsteknologi: 550TelemedicineStandardizationHL7
researchProduct

A Smartphone App to Promote Healthy Weight Gain, Diet, and Physical Activity During Pregnancy (HealthyMoms): Protocol for a Randomized Controlled Tri…

2019

BACKGROUND: Excessive gestational weight gain is common and associated with adverse outcomes both in the short and long term. Although traditional lifestyle-based interventions have shown to mitigate excess gestational weight gain, little is known about whether mobile Health (mHealth) apps can promote healthy weight gain, diet, and physical activity during pregnancy. OBJECTIVE: The primary aim of the HealthyMoms trial is to determine the effectiveness of a smartphone app (HealthyMoms) for mitigating excess gestational weight gain during pregnancy. Secondary aims are to determine the effectiveness of the app on dietary habits, physical activity, body fatness, and glycemia during pregnancy. M…

Original Papermobile phoneNutrition and DieteticsexercisekuntoliikuntaraskaussmartphonepainonhallintatelelääketiedeNäringsläragestational weight gainmobiilisovelluksettelemedicinepregnancyteleterveydenhuoltodietJMIR Research Protocols
researchProduct