Search results for "tocols"

showing 10 items of 784 documents

Lifestyle and Empowerment Techniques in Survivorship of Gynaecologic Oncology (LETSGO study): A study protocol for a multicentre longitudinal interve…

2021

IntroductionThe number of gynaecological cancer survivors is increasing and there is a need for a more sustainable model of follow-up care. Today’s follow-up model is time-consuming and patients have reported unmet needs regarding information about their cancer and strategies for managing the consequences of treatment. The main aim of this study is to assess health-related empowerment—in terms of patient education, psychosocial support, and promotion of physical activity—in a new follow-up model by comparing it to standard follow-up in a quasi-randomised study involving intervention hospitals and control hospitals.Methods and analysisAt the intervention hospitals, patients will be stratifie…

protocols & guidelinesSurvivorship0302 clinical medicineinformation technologyHealth careMulticenter Studies as Topichealth economics030212 general & internal medicine1506Empowermentmedia_commonBiological Specimen BanksRandomized Controlled Trials as TopicRHealth technologyPublic Health Global Health Social Medicine and EpidemiologyGeneral MedicineBiobankOncologyVDP::Medisinske Fag: 700::Helsefag: 800030220 oncology & carcinogenesisCancer treatmentMedicineFemale1717Hälso- och sjukvårdsorganisation hälsopolitik och hälsoekonomimedicine.medical_specialtyGenital Neoplasms Femalemedia_common.quotation_subjectHealth-related empowermentBiomedical Technologyquality in health care03 medical and health sciencesQuality of life (healthcare)medicineHumansLife StyleConsequencesGynaecological cancerHealth economicsbusiness.industryVDP::Medical disciplines: 700::Clinical medical disciplines: 750::Oncology: 762gynaecological oncologychange managementRepeated measures designHealth Care Service and Management Health Policy and Services and Health EconomyVDP::Medisinske Fag: 700::Klinisk medisinske fag: 750::Onkologi: 762Folkhälsovetenskap global hälsa socialmedicin och epidemiologiFamily medicineQuality of LifeFollow-up careNeoplasm Recurrence LocalbusinessPatient education
researchProduct

Multidimensional instruments with an integral approach to identify frailty in community-dwelling people: protocol for a systematic psychometric review

2019

IntroductionAn increasing number of investigations highlight the complex nature of frailty; therefore, the use of multidimensional assessment instruments could be useful in clinical decision-making. Frail people are found mainly in the community setting which is why this is the ideal environment for early screening and intervention. For this purpose, it is necessary to have valid, time-effective and easy-to-use frailty assessment instruments. The aim of this review is to critically appraise, compare and summarise the quality of the measurement properties of all multidimensional instruments with an integral approach to identify frailty in community-dwelling people.Methods and analysisMedline…

psychometrics:disciplinas y actividades conductuales::pruebas psicológicas::psicometría [PSIQUIATRÍA Y PSICOLOGÍA]PsychometricsHealth StatusApplied psychologyGeriatric MedicinePsycINFO:Therapeutics::Clinical Protocols [ANALYTICAL DIAGNOSTIC AND THERAPEUTIC TECHNIQUES AND EQUIPMENT]0302 clinical medicinesystematic reviewInfermeriaProtocolMedicine030212 general & internal medicine1506Primary health careFrailty:afecciones patológicas signos y síntomas::procesos patológicos::fragilidad [ENFERMEDADES]General MedicineGrey literatureChecklistcommunity-dwellingChecklistCribratgeAtenció primàriaResearch Design:Behavioral Disciplines and Activities::Psychological Tests::Psychometrics [PSYCHIATRY AND PSYCHOLOGY]Independent LivingProtocols clínicsPsicometriaGerontologiaConsensusPsychometricsMedical screeningHabitatgesMEDLINE:terapéutica::protocolos clínicos [TÉCNICAS Y EQUIPOS ANALÍTICOS DIAGNÓSTICOS Y TERAPÉUTICOS]:Terapéutica::Protocolos Clínicos [TÉCNICAS Y EQUIPOS ANALÍTICOS DIAGNÓSTICOS Y TERAPÉUTICOS]Context (language use)CINAHLRessenyes sistemàtiques (Investigació mèdica)03 medical and health sciencesprimary healthcare:Pathological Conditions Signs and Symptoms::Pathologic Processes::Frailty [DISEASES]Systematic reviews (Medical research)HumansProtocol (science)business.industry1698screeningDwellingsSalut - FragilitatQuality of LifebusinessGeriatria030217 neurology & neurosurgerySystematic Reviews as Topic
researchProduct

Analysis of MAC-level throughput in LTE systems with link rate adaptation and HARQ protocols

2015

LTE is rapidly gaining momentum for building future 4G cellular systems, and real operational networks are under deployment worldwide. To achieve high throughput performance, in addition to an advanced physical layer design LTE exploits a combination of sophisticated mechanisms at the radio resource management layer. Clearly, this makes difficult to develop analytical tools to accurately assess and optimise the user perceived throughput under realistic channel assumptions. Thus, most existing studies focus only on link-layer throughput or consider individual mechanisms in isolation. The main contribution of this paper is a unified modelling framework of the MAC-level downlink throughput of …

radio linksaccess protocolscellular radioSettore ING-INF/03 - Telecomunicazionibusiness.industryOrthogonal frequency-division multiplexingComputer science4G mobile communicationComputerSystemsOrganization_COMPUTER-COMMUNICATIONNETWORKSPhysical layerHybrid automatic repeat requestComputer architectureTelecommunications linkLong Term EvolutionLTE MAC CQI AMC HARQ throughput analysis.Isolation (database systems)Radio resource managementbusinessThroughput (business)Computer networkCommunication channel2015 IEEE 16th International Symposium on A World of Wireless, Mobile and Multimedia Networks (WoWMoM)
researchProduct

Abemaciclib: safety and effectiveness of a unique cyclin-dependent kinase inhibitor

2020

Introduction: The discovery and the clinical availability of novel cyclin-dependent kinases 4 and 6 inhibitors have profoundly changed the therapeutic scenario of metastatic hormone receptor-positive breast carcinoma. Among these inhibitors, abemaciclib can induce potent and sustained cell cycle arrest and immune system stimulation. Areas covered: This review summarizes the safety profile and clinical efficacy data on abemaciclib alone or in combination with aromatase inhibitors or fulvestrant in metastatic hormone receptor-positive breast carcinoma. The management of patients treated with abemaciclib is the object of this paper. Expert opinion: As shown in phase 2 and 3 clinical trials on …

safetyAminopyridinesBreast Neoplasms030204 cardiovascular system & hematology03 medical and health scienceschemistry.chemical_compoundabemaciclib breast cancer metastases hormonal receptors safetybreast cancer0302 clinical medicineBreast cancerCyclin-dependent kinaseAntineoplastic Combined Chemotherapy ProtocolsmedicineHumansPharmacology (medical)metastasesskin and connective tissue diseasesFulvestrantProtein Kinase InhibitorsAbemaciclibbiologyAromatase Inhibitorsbusiness.industryKinasehormonal receptorsCyclin-Dependent Kinase 4Cell Cycle CheckpointsCyclin-Dependent Kinase 6General Medicinemedicine.diseaseAbemaciclibchemistry030220 oncology & carcinogenesisQuality of LifeCancer researchbiology.proteinBenzimidazolesFemalesense organsbusinessHormone
researchProduct

Impact of Structural, Photochemical and Instrumental Effects on Leaf and Canopy Reflectance Variability in the 500–600 nm Range

2021

Current rapid technological improvement in optical radiometric instrumentation provides an opportunity to develop innovative measurements protocols where the remote quantification of the plant physiological status can be determined with higher accuracy. In this study, the leaf and canopy reflectance variability in the PRI spectral region (i.e., 500–600 nm) is quantified using different laboratory protocols that consider both instrumental and experimental set-up aspects, as well as canopy structural effects and vegetation photoprotection dynamics. First, we studied how an incorrect characterization of the at-target incoming radiance translated into an erroneous vegetation reflectance spectru…

spectroscopyreflectanceproximal sensing; spectroscopy; protocols; irradiance; reflectance; vegetation index; sun-/shade-adapted leaves; xanthophyll cycleirradianceScienceQGeneral Earth and Planetary Sciencesprotocolsproximal sensingvegetation indexRemote Sensing
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

H.264 QoS and Application Performance with Different Streaming Protocols

2015

Streaming techniques, including the selected streaming protocol, have an effect on the streaming quality. In this study, the performance of three different streaming protocols in a disturbed communication channel is evaluated with a modified version of the FFPlay player. A H.264 encoded video is used as a test sequence. The number of displayed image frames, the frame rate and playout duration are used as objective metrics for QoS. The metrics brings out differences of streaming protocols in our test environment. They are measured at the application level and have a connection to the user experience. peerReviewed

ta113Protocol (science)HLSbusiness.industryComputer sciencecomputer.internet_protocolQuality of serviceReal-time computingstreaming protocolsQoSFrame rateRTSPTest sequenceUser experience designRTMPReal Time Streaming ProtocolQoEH.264businesscomputerComputer networkProceedings of the 8th International Conference on Mobile Multimedia Communications
researchProduct

ESSAI RANDOMISÉ POUR ÉVALUER L’EFFICACITÉ ET LA SÉCURITÉ DE TRAITEMENTS CHEZ DES PATIENTS AMBULATOIRES ATTEINTS DE COVID-19 AYANT DES FACTEURS DE RIS…

2021

Context. The Covid-19 pandemic is of unprecedented magnitude and has had major social and health consequences. Primary care professionals, mainly general practitioners, ensure the care of most patients with Covid-19. An early-stage treatment administered to patients with risk factors for developing a severe disease could reduce hospitalization and death rates. No treatment is currently validated in this indication. Objectives. To evaluate the safety and efficacy of experimental candidate agents delivered in outpatient settings to reduce the risk of hospitalization or death in at-risk patients with early-stage proven Covid-19 and no indication for hospital admission. Methods. Multicentric, o…

treatment[SDV]Life Sciences [q-bio]protocolstrialInternalcontrolledclinical[SDV] Life Sciences [q-bio]earlyrandomizedoutpatientMedicineGeneralCovid-19
researchProduct

Comparison of inter-trial recovery times for the determination of critical power and W' in cycling

2017

Critical Power (CP) and W’ are often determined using multi-day testing protocols. To investigate this cumbersome testing method, the purpose of this study was to compare the differences between the conventional use of a 24-h inter-trial recovery time with those of 3 h and 30 min for the determination of CP and W’. Methods: 9 moderately trained cyclists performed an incremental test to exhaustion to establish the power output associated with the maximum oxygen uptake (p V O2max), and 3 protocols requiring time-to-exhaustion trials at a constant work-rate performed at 80%, 100% and 105% of p VO2max. Design: Protocol A utilised 24-h inter-trial recovery (CP24/W’24), protocol B utilised 3-h in…

validityTime FactorsTime Factorpower-duration relationshipPhysical Therapy Sports Therapy and RehabilitationAthletic Performance030204 cardiovascular system & hematology03 medical and health sciencesRecovery periodOxygen Consumption0302 clinical medicineAnimal scienceTesting protocolsHumansOrthopedics and Sports MedicinePower outputSimulationMathematicsexercise testingLimits of agreementVO2 max030229 sport sciencesQPIncremental testBicyclinganaerobic work capacityCritical intensityMuscle FatigueCritical powerExercise TestCyclingGVHuman
researchProduct

A framework for Population Protocols in VANETs

2023

vanetpopulation protocols
researchProduct