Search results for "tolerability"

showing 10 items of 372 documents

Antipsychotic effects and tolerability of the sigma ligand EMD 57445 (panamesine) and its metabolites in acute schizophrenia: an open clinical trial.

2000

Antipsychotic efficacy and side effects of the selective sigma ligand EMD 57445 (panamesine) were investigated in 12 patients (6 males, 6 females) who met DSM-III-R criteria for schizophrenia. A 4-week open clinical study revealed only modest effects of EMD 57445 and its metabolites on positive and negative symptoms of schizophrenia. Extrapyramidal and other side effects were moderate, although a significant increase in mild dyskinetic movements was found. Five patients, four of whom were females, completed the trial. Dropouts were mainly due to treatment failure. Antipsychotic effects were significantly greater in female than male patients.

AdultMalemedicine.medical_specialtyPsychosismedicine.medical_treatmentSigma receptorPanamesineDrug Administration ScheduleBasal Ganglia DiseasesPiperidinesInternal medicinemental disordersmedicineHumansReceptors sigmaAntipsychoticOxazolesBiological PsychiatryBiotransformationAgedPsychiatric Status Rating ScalesDose-Response Relationship DrugMiddle Agedmedicine.diseaseClinical trialPsychiatry and Mental healthEndocrinologyTreatment OutcomeTolerabilityDopamine receptorSchizophreniaAcute DiseaseSchizophreniaFemaleSchizophrenic PsychologyPsychologyAntipsychotic AgentsPsychiatry research
researchProduct

Comparison of topical tacrolimus 0.1 % in pectin ointment with clobetasol 0.5% ointment in adults with moderate to severe desquamative gingivitis: A …

2006

BACKGROUND: Desquamative gingivitis (DG) is a clinical condition characterized by red, painful, glazed, and friable gingiva, which might be a manifestation of some autoimmune mucocutaneous diseases. The time from the development of initial signs of DG to diagnosis can vary from months to years. Based on a literature search, no data concerning patients with DG without signs of autoimmune disease were available. OBJECTIVE: The aim of this trial was to compare the efficacy and tolerability of monotherapy with topical tacrolimus 0.1% in pectin ointment versus clobetasol propionate 0.5% ointment in adults affected by DG. METHODS: This randomized, double-blind clinical trial was conducted at the …

AdultMalemedicine.medical_specialtySettore MED/09 - Medicina InternaErythemaAdministration TopicalPopulationSeverity of Illness IndexTacrolimuslaw.inventionOintmentsRandomized controlled trialDouble-Blind Methodlawdesquamative gingivitimedicineClinical endpointHumansPharmacology (medical)educationAgedPharmacologyeducation.field_of_studyDose-Response Relationship Drugbusiness.industryMiddle Agedmedicine.diseaseDermatologyGingivitisdesquamative gingivitisTacrolimusSurgeryDesquamative gingivitisTreatment OutcomeTolerabilityclobetasoltopical tacrolimus; clobetasol; desquamative gingivitis; randomized double-blind clinical trialtacrolimus clobetasol desquamative gingivitisPectinsDrug Therapy CombinationFemaleClobetasol propionatemedicine.symptombusinessImmunosuppressive Agentsmedicine.drugFollow-Up Studiestopical tacrolimurandomized double-blind clinical trial
researchProduct

Beclomethasone dipropionate in Crohn's ileitis: A randomised, double-blind trial.

2011

Abstract Background Steroids, the mainstay of Crohn's disease treatment, have been associated with systemic side effects. Aim To evaluate the efficacy and tolerability of beclomethasone dipropionate for maintaining remission induced by a short course of systemic steroids in patients with Crohn's ileitis with or without right colonic involvement. Methods Patients (n = 84) with active Crohn's disease who achieved remission during a 2-week prednisone run-in period were randomised to receive beclomethasone dipropionate for 24 weeks or continue prednisone for a further 2 weeks followed by placebo for 22 weeks. The primary outcome was relapse rate (Crohn's Disease Activity Index score > 150 and a…

AdultMalemedicine.medical_specialtySettore MED/09 - Medicina InternaRemissionKaplan-Meier EstimateBeclomethasone dipropionate Crohn's disease RemissionPlaceboGastroenterologyDrug Administration ScheduleMedication Adherencelaw.inventionDouble blindCrohn DiseaseDouble-Blind MethodRandomized controlled triallawPrednisoneInternal medicineSecondary PreventionmedicineHumansIleitisAdverse effectGlucocorticoidsAgedCrohn's diseaseHepatologybusiness.industryRemission InductionBeclomethasoneGastroenterologyBeclomethasone dipropionate Crohn's ileitis:.Middle Agedmedicine.diseaseSurgeryBeclomethasone dipropionateCrohn's diseaseTreatment OutcomeTolerabilityPrednisoneFemaleTablets Enteric-Coatedbusinessmedicine.drug
researchProduct

Sulodexide versus calcium heparin in the medium-term treatment of deep vein thrombosis of the lower limbs.

1997

Thirty adult patients with distal, monolateral deep vein thrombosis of the lower limbs were randomly treated for sixty days either with subcutaneous Ca-Heparin or with Sulodexide, administered IM for ten days and orally for fifty days. The thrombus accretion above the knee, the venous pressures of the affected leg, the clinical sympto matology, and some laboratory coagulative tests were monitored throughout the admin istration period. Local tolerability of the two treatments was also evaluated.The two applied treatments evidenced a net antithrombotic activity, preventing thrombus accretion above the knee, improving with the same efficacy the venous pressures in the affected legs, and simila…

AdultMalemedicine.medical_specialtySettore MED/09 - Medicina Internamedicine.drug_classDeep vein030204 cardiovascular system & hematology03 medical and health sciences0302 clinical medicineFibrinolytic AgentsHumansMedicine030212 general & internal medicineThrombusAgedGlycosaminoglycansmedicine.diagnostic_testHeparinbusiness.industryAnticoagulantHeparinMiddle AgedThrombophlebitismedicine.diseaseThrombosisSulodexideSurgerymedicine.anatomical_structureTolerabilityAnesthesiaSettore BIO/14 - FarmacologiaFemaleAdult Aged Female Fibrinolytic Agents/administration & dosage Fibrinolytic Agents/therapeutic use* Glycosaminoglycans/administration & dosage Glycosaminoglycans/therapeutic use* Heparin/therapeutic use* Humans Male Middle Aged Thrombophlebitis/drug therapy*Cardiology and Cardiovascular Medicinebusinessmedicine.drugPartial thromboplastin time
researchProduct

Long-term efficacy and tolerability of intranasal fentanyl in the treatment of breakthrough cancer pain

2015

Purpose: The aim of the present study was to assess the long-term tolerability and efficacy of intranasal fentanyl (INFS) in opioid-tolerant patients with breakthrough cancer pain (BTP).Patients and methods: A 6 months, observational, prospective, cohort study design was employed to follow advanced cancer patients with BTP receiving INFS under routine clinical practice. Eligible adult cancer patients suffering from BTP had been prescribed INFS at effective doses. Data were collected at T0 and at month intervals for six months. The principal outcomes were the evaluation of possible serious adverse effects with prolonged use of INFS, the efficacy of BTP treatment with INFS, the quality of sle…

AdultMalemedicine.medical_specialtySettore MED/42 - Igiene Generale E ApplicataFentanylCohort StudiesPatient satisfactionNeoplasmsInternal medicineparasitic diseasesHumansPain ManagementMedicineProspective StudiesCancer painAdverse effectProspective cohort studyAdministration IntranasalAgedPain Measurementbusiness.industryBreakthrough PainMiddle AgedTolerabilityDiscontinuationAnalgesics OpioidFentanylBreakthrough pain; Cancer pain; Intranasal fentanyl; Tolerability; OncologyOncologyTolerabilityPatient SatisfactionAnesthesiaIntranasal fentanylFemaleSleepbusinessCancer painmedicine.drugCohort studySupportive Care in Cancer
researchProduct

Electromyographic and Safety Comparisons of Common Lower Limb Rehabilitation Exercises for People With Hemophilia.

2020

Abstract Background Ankles and knees are commonly affected in people with hemophilia and thus are targets for prevention or rehabilitation. However, to our knowledge, no studies have evaluated muscle activity and safety during exercises targeting the lower limbs in people with hemophilia; this lack of information hinders clinical decision-making. Objective The aim of this study was to compare the tolerability of, safety of, and muscle activity levels obtained with external resistance (elastic or machine)-based and non–external resistance-based lower limb exercises in people with hemophilia. Design This was a cross-sectional study. Methods Eleven people who had severe hemophilia and were und…

AdultMalemedicine.medical_specialtyTime FactorsKnee Jointmedicine.medical_treatmentPhysical Therapy Sports Therapy and RehabilitationElectromyographyHemophilia ABicepsHemophilia BLower limb03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationHemarthrosismedicineHumans030212 general & internal medicineMuscle activityAdverse effectMuscle SkeletalRehabilitationExercise Tolerancemedicine.diagnostic_testbusiness.industryElectromyographyResistance TrainingExercise Therapymedicine.anatomical_structureCross-Sectional StudiesTolerabilityAnklebusiness030217 neurology & neurosurgeryAnkle JointPhysical therapy
researchProduct

Defer or treat? Reasons for treatment decisions in patients with chronic hepatitis C genotype 1 in the early era of directly acting antiviral agents

2013

Abstract Background In chronic genotype 1 hepatitis C, telaprevir or boceprevir plus peginterferon and ribavirin have become the new standard of care. Aim of this study was to identify factors contributing to the decision whether to defer or treat with the current triple regimens. Methods Prospective assessment of eight parameters on 0-4-point scales by the attending physician at a German tertiary referral centre between 1st September 2011 and 31st December 2012. Results 307 patients were evaluated at least once by one of the 11 hepatologists involved; 267 patients were considered, but only 163 were recommended to receive triple therapy. Multivariate regression analysis revealed that a high…

AdultMalemedicine.medical_specialtyTime FactorsProlineDecision MakingHepacivirusPharmacologyAntiviral AgentsSeverity of Illness IndexPolyethylene GlycolsTelaprevirCohort Studieschemistry.chemical_compoundFibrosisBoceprevirInternal medicineDrug DiscoveryRibavirinGenotypemedicineHumansDecompensationProspective StudiesWatchful WaitingAgedDrug CarriersHepatologybusiness.industryRibavirinGastroenterologyInterferon-alphaPatient PreferenceHepatitis CHepatitis C ChronicMiddle Agedmedicine.diseaseLogistic ModelschemistryTolerabilityMultivariate AnalysisDisease ProgressionDrug Therapy CombinationFemalebusinessOligopeptidesmedicine.drugDigestive and Liver Disease
researchProduct

Antigen-Specific Immunotherapy with Thyrotropin Receptor Peptides in Graves' Hyperthyroidism: A Phase I Study

2019

Background: Graves' disease is one of the most common autoimmune conditions, but treatment remains imperfect. This study explores the first-in-human use of antigen-specific immunotherapy with a combination of two thyrotropin receptor (TSHR) peptides (termed ATX-GD-59) in Graves' hyperthyroidism. Methods: Twelve participants (11 female) with previously untreated mild to moderate Graves' hyperthyroidism were enrolled in a Phase I open label trial to receive 10 doses of ATX-GD-59 administered intradermally over an 18-week period. Adverse events, tolerability, changes in serum free thyroid hormones, and TSHR autoantibodies were measured. Results: Ten subjects received all 10 doses of ATX-GD-59,…

AdultMalemedicine.medical_specialtyendocrine systemendocrine system diseasesInjections Intradermalthyroid stimulating hormone receptorEndocrinology Diabetes and Metabolismmedicine.medical_treatmentGraves' diseasedesensitization030209 endocrinology & metabolismDiseaseImmunology Autoimmunity and Graves’ OphthalmopathyimmunomodulationThyrotropin receptor03 medical and health sciences0302 clinical medicineEndocrinologyInternal medicinemedicineHumansAdverse effectDesensitization (medicine)business.industryAutoantibodypeptide immunotherapyReceptors ThyrotropinImmunotherapyMiddle Agedmedicine.diseaseGraves' diseaseGraves Disease3. Good healthInjection Site ReactionThyroxineEndocrinologyTreatment OutcomeTolerabilityDesensitization Immunologic030220 oncology & carcinogenesisTriiodothyronineFemaleautoimmune thyroid diseasebusinessPeptidesImmunoglobulins Thyroid-StimulatingThyroid
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Effects of Intravenous Erythromycin Lactobionate in Respiratory Infections

1987

The antibiotic erythromycin lactobionate given intravenously acts almost exclusively on Gram-positive bacteria. Even at high plasma and tissue concentrations there is an almost total absence of side-effects. It could be considered, therefore, as first choice in the treatment of patients with infectious respiratory diseases. Most of the 40 patients admitted to the present study were elderly and all had either acute or chronic and becoming acute respiratory disease. Their clinical symptoms and levels of phlogosis improved on treatment with erythromycin lactobionate without any interruption of therapy due to side-effects and toxicity. The absence of unfavourable pharmacological interactions f…

AdultMalemedicine.medical_specialtymedicine.drug_classmedicine.medical_treatmentAntibioticsErythromycinBiochemistryGastroenterologyErythromycin LactobionateInternal medicinemedicineHumansInfusions IntravenousRespiratory Tract InfectionsAgedChemotherapyBacteriaRespiratory tract infectionsbusiness.industryBiochemistry (medical)Respiratory diseaseCell BiologyGeneral MedicineMiddle Agedmedicine.diseaseErythromycinSurgeryTolerabilityToxicityFemalebusinessmedicine.drugJournal of International Medical Research
researchProduct