Search results for "tv"

showing 10 items of 4565 documents

Fotogrammetrisen 3D-latvusmallin ja hyperspektriaineiston käyttö aluetason puustotulkinnassa

2017

Seloste artikkelista Tuominen S., Balazs A., Honkavaara E., Polonen I., Saari H., Hakala T., Viljanen N. (2017). Hyperspectral UAV-imagery and photogrammetric canopy height model in estimating forest stand variables. Silva Fennica vol. 51 no. 5 article id 7721. https://doi. org/10.14214/sf.7721

ta113CanopyHyperspectral imagingForestryForestrymallitSD1-669.5ta4112latvusmetsänarviointiGeographypuustoCartography
researchProduct

Nil de nihilo fit princips izmeklētāja atbildībā kriminālprocesā

2016

Izmeklētāja atbildība ir kriminālprocesa rezultāts – ja izmeklētājs, kriminālprocesu uzsākot, nepareizi rīkojas procesuālās darbībās, pierādījumu izņemšanā vai noskaidrošanā, tas var būtiski ietekmēt pierādījumu pieļaujamību kriminālprocesā un novest pie kriminālprocesa izbeigšanas pierādījumu trūkuma dēļ. (nil de nihilo fit princips- tulk. no latīņu val. no nekā nekas nerodas) Tas pārkāpj LR Satversmes 92.pantu - ikvienam ir tiesības uz taisnīgu tiesu un atbilstīgu nodarītā atlīdzinājumu. Jēdziens “izmeklētājs” kriminālprocesa izpratnē kādreiz bijis profesija, laika gaitā šis jēdziens no likuma izņemts, šobrīd Kriminālprocesa likums pieļauj izmeklēšanas darbības vienā kriminālprocesā veikt…

taisnīga tiesaizmeklētāja profesionālā kvalifikācijaizmeklētāja pilnvarasnepieļaujami pierādījumiLR Satversmes pārkāpumsJuridiskā zinātne
researchProduct

Vēlētāju likumdošanas iniciatīva Latvijā un ārvalstīs

2018

Viens no tiešās demokrātijas izpausmes veidiem ir vēlētāju likumdošanas iniciatīva, kas ļauj pilsoņu kopumam piedalīties likumdošanas procesā, tādējādi izsakot savu gribu un lemjot par sev svarīgiem un nozīmīgiem jautājumiem. Vēlētāju likumdošanas iniciatīvas tiesības pastāv arī Latvijā. Maģistra darba “Vēlētāju likumdošanas iniciatīva Latvijā un ārvalstīs” rezultātā, analizējot Latvijas un citu valstu regulējumu, kā arī tiesu praksi, konstatēts, ka Latvijā vēlētāju likumdošanas iniciatīvas nespēj no likumprojekta kļūt par likumu nepietiekamas vēlētāju aktivitātes dēļ, turklāt sabiedrībā nereti rodas diskusijas par vēlētāju likumdošanas iniciatīvas regulējuma efektivitāti. Darbā sniegti ier…

tautas nobalsošanatiešā demokrātijavēlētāju iniciatīvalikumprojektsSatversmeJuridiskā zinātne
researchProduct

Ārvalstu tiešās investīcijas un to loma Latvijas ekonomikas attīstībā

2017

Bakalaura darba tēma ir “Ārvalstu tiešās investīcijas un to loma Latvijas ekonomikas attīstībā.” Bez ārvalstu kapitāla Latvijas tautsaimniecības izaugsme nebūtu bijusi tik strauja, jo iekšējo kapitāla resursu, kurus būtu iespējams ieguldīt tautsaimniecībā, bija maz. Pēdējos gados ārvalstu investīciju ieplūde Latvijā stagnē un arī ekonomiskā izaugsme ir vien mērena. Lai sasniegtu atkal straujāku ekonomisko izaugsme, ir nepieciešami novērst ĀTI kavējošos faktorus. Bakalaura darba mērķis ir izpētīt ārvalstu tiešo investīciju ietekmi uz Latvijas tautsaimniecības attīstību, atklāt investīciju piesaistes kavējošos iekšējos un ārējos faktorus un veikt secinājumus, kā arī dot priekšlikumus investīc…

tautsaimniecības attīstībaLatvijas tautsaimniecībaEkonomikaārvalstu tiešās investīcijasinvestīcijasLatvijas investīciju vide
researchProduct

Models of tax payments of performers of economic activity in Latvia

2019

Economic theory sources widely discuss the fiscal policy, the ways of encouraging economic development, improve the welfare of people, improve employment and promote progress by fiscal instruments. On one side, it is possible to use the expenditure policy, on the other side, tax revenue can be optimised by reducing tax gaps. State officials often view self-employment as a missed opportunity deserving more focused attention. The European Union also supports this position. The question of self-employment is important for performers of economic activity. The aim of the research: on the basis of theoretical (legislative) and empirical analysis to find out advantages and disadvantages of tax pay…

tax payment:SOCIAL SCIENCES::Business and economics [Research Subject Categories]Latviaperformer of economic activity
researchProduct

ICTV Virus Taxonomy Profile : Finnlakeviridae

2020

Finnlakeviridae is a family of icosahedral, internal membrane-containing bacterial viruses with circular, single-stranded DNA genomes. The family includes the genus, Finnlakevirus, with the species, Flavobacterium virus FLiP. Flavobacterium phage FLiP was isolated with its Gram-negative host bacterium from a boreal freshwater habitat in Central Finland in 2010. It is the first described single-stranded DNA virus with an internal membrane and shares minimal sequence similarity with other known viruses. The virion organization (pseudo T=21 dextro) and major capsid protein fold (double-β-barrel) resemble those of Pseudoalteromonas phage PM2 (family Corticoviridae), which has a double-stranded …

taxonomysingle-stranded DNA phageviruksetvirusessystematiikka (biologia)flavobacterium phage FLiPICTV reportFinnlakeviridaebakteriofagiticosahedral membrane-containing virus
researchProduct

ICTV Virus Taxonomy Profile: Sphaerolipoviridae 2023

2023

Members of the family Sphaerolipoviridae have non-enveloped tailless icosahedral virions with a protein-rich internal lipid membrane. The genome is a linear double-stranded DNA of about 30 kbp with inverted terminal repeats and terminal proteins. The capsid has a pseudo triangulation T=28 dextro symmetry and is built of two major capsid protein types. Spike complexes decorate fivefold vertices. Sphaerolipoviruses have a narrow host range and a lytic life cycle, infecting haloarchaea in the class Halobacteria (phylum Euryarchaeota). This is a summary of the International Committee on Taxonomy of Viruses (ICTV) Report on the family Sphaerolipoviridae, which is available at ictv.global/report/…

taxonomyviruksetsphaerolipoviridaesystematiikka (biologia)ICTV report
researchProduct

ICTV Virus Taxonomy Profile : Simuloviridae 2023

2023

The family Simuloviridae includes tailless icosahedral viruses with an internal lipid membrane. The capsid is constructed from two major capsid proteins, both with a single jelly-roll fold. The genome is a circular dsDNA molecule of 16–19 kb. All members infect halophilic archaea in the class Halobacteria (phylum Euryarchaeota) and are temperate viruses, their proviruses residing in host cells as extrachromosomal episomes. Once the lytic life cycle is triggered, production of virions causes cell lysis. This is a summary of the International Committee on Taxonomy of Viruses (ICTV) Report on the family Simuloviridae, which is available at ictv.global/report/simuloviridae. peerReviewed

taxonomyviruksetsystematiikka (biologia)simuloviridaeICTV report
researchProduct

Policy-practice gap in participation of students with disabilities in the education and training programme of Ethiopia: policy content analysis

2015

This study explores the extent to which the issue of special educational and training needs for persons with disabilities is addressed in the education and training policy of Ethiopia, with a specific focus on technical and vocational education and training (TVET). Focus group discussions and interviews were used to assess the content of the policy and related strategic documents, as well as legal frameworks and implementation instruments, in terms of the principle of inclusion. A pair of focus group discussions involved 22 members of the management and governance of four networks and eight indigenous, disability-focused, non-governmental organisations. Moreover, 14 high-profile experts fro…

techical and vocational education and trainingTVETanalyysipolicy developmentEthiopiainkluusiopersons with disabilities
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct