Search results for "valvontajärjestelmät"

showing 8 items of 8 documents

Sarbanes-Oxley -lain ja Suomen tilintarkastuslain merkittävimmät erot yritysten näkökulmasta

2005

direktiivitSarbanes-Oxley -lakivalvontajärjestelmättilintarkastuskomiteatilintarkastusriippumattomuustilintarkastuslaki
researchProduct

Anomaly-based online intrusion detection system as a sensor for cyber security situational awareness system

2016

Almost all the organisations and even individuals rely on complex structures of data networks and networked computer systems. That complex data ensemble, the cyber domain, provides great opportunities, but at the same time it offers many possible attack vectors that can be abused for cyber vandalism, cyber crime, cyber espionage or cyber terrorism. Those threats produce requirements for cyber security situational awareness and intrusion detection capability. This dissertation concentrates on research and development of anomaly-based network intrusion detection system as a sensor for a situational awareness system. In this dissertation, several models of intrusion detection systems are devel…

early warningpääsynvalvontatunkeilijan havaitsemisjärjestelmätcyber securityvalvontajärjestelmättilannekuvaanomaly detectionsituational awarenessinformation sharingnetwork securityintrusion detection systemklusterianalyysitiedonlouhintakyberturvallisuustietoverkotclustering
researchProduct

Knowledge discovery using diffusion maps

2013

knowledge discoveryskientometriikkaanalyysimenetelmätdata miningvalvontajärjestelmätanomaly detectionkoneoppiminentoiminnallinen magneettikuvausdatabig datamanifold learningalgoritmitdiffusion mapstiedonlouhintateollisuuskyberturvallisuusclusteringdimensionality reduction
researchProduct

UInDeSI4.0 : An efficient Unsupervised Intrusion Detection System for network traffic flow in Industry 4.0 ecosystem

2023

In an Industry 4.0 ecosystem, all the essential components are digitally interconnected, and automation is integrated for higher productivity. However, it invites the risk of increasing cyber-attacks amid the current cyber explosion. The identification and monitoring of these malicious cyber-attacks and intrusions need efficient threat intelligence techniques or intrusion detection systems (IDSs). Reducing the false positive rate in detecting cyber threats is an important step for a safer and reliable environment in any industrial ecosystem. Available approaches for intrusion detection often suffer from high computational costs due to large number of feature instances. Therefore, this paper…

principal component analysisintrusion detectionisolation forestälytekniikkaICAvalvontajärjestelmätindustry 4.0kyberturvallisuustuotantotekniikkaverkkohyökkäyksetrandom forest
researchProduct

Intrusion detection applications using knowledge discovery and data mining

2014

pääsynvalvontaintrusion detectionknowledge discoverydata miningvalvontajärjestelmätanomaly detectionbig dataalgoritmitklusterianalyysitietoturvatiedonlouhintakyberturvallisuusverkkohyökkäyksetdimensionality reductionclustering
researchProduct

Towards CCTV-aware Routing and Navigation for Privacy, Anonymity, and Safety - Feasibility Study in Jyväskylä

2021

AbstractIn order to withstand the ever-increasing invasion of privacy by CCTV cameras and technologies, on par CCTV-aware solutions must exist that provide privacy, safety, and cybersecurity features. We argue that a first important step towards such CCTV-aware solutions must be a mapping system (e.g., Google Maps, OpenStreetMap) that provides both privacy and safety routing and navigation options. Unfortunately, to the best of our knowledge, there are no mapping nor navigation systems that support CCTV-privacy and CCTV-safety routing options. At the same time, in order to move the privacy vs. safety debate related to CCTV surveillance cameras from purely subjective to data-driven and evide…

safetyComputer sciencePrivacy laws of the United StatesContext (language use)PedestrianprivacyComputer securitycomputer.software_genrelcsh:TelecommunicationDomain (software engineering)anti-surveillancelcsh:TK5101-6720yksityisyyskameravalvontakarttapalvelutcctv-aware technologymappingnavigationreititysanonymityNavigation systemvalvontajärjestelmätcctvroutingsurveillanceRouting (electronic design automation)anonymiteettiScale (map)yksilönsuojacomputerAnonymity2021 28th Conference of Open Innovations Association (FRUCT)
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Video Streaming and Internalized Surveillance

2018

This paper aims to develop knowledge about the complicated ways in which the modern individual uses surveillance (techniques) and the ways surveillance uses the individual. My observational analysis of a videostreaming community reveals the central role that surveillance plays in participating and becoming visible in an online environment. The results show that through disciplinary and lateral surveillance, participants produced context-defined I-narrations and formed themselves following the normative judgment of the environment. The same mechanism may be observed in other videostreaming social media environments and the modern social media-saturated society in general. This is an inconspi…

ta113videostreamingMultimediaminäkuvaComputer sciencevisuaalinen viestintäsosiaalinen mediaitseilmaisuvalvontajärjestelmätvideotmodern individualcomputer.software_genreUrban Studiesyksilökontrollisosiaaliset verkostotsosiaalinen ympäristöidentiteettiVideo streamingtarkkailuvalvontayksilöllisyysSafety Researchcomputer
researchProduct