Search results for "waves"

showing 10 items of 1766 documents

Stationary entanglement of photons and atoms in a high-finesse resonator

2013

We predict that the collective excitations of an atomic array become entangled with the light of a high-finesse cavity mode when they are suitably coupled. This entanglement is of Einstein-Podolsky-Rosen type, it is robust against cavity losses and is a stationary property of the coupled system. It is generated when the atomic array is aligned along the cavity axis and driven transversally by a laser, when coherent scattering of photons into the cavity mode is suppressed because of phase-mismatching. We identify the parameter regimes under which entanglement is found and show that these are compatible with existing experimental setups.

PhysicsQuantum PhysicsPhotonScatteringCavity quantum electrodynamicsPhase (waves)Physics::OpticsFOS: Physical sciencesQuantum entanglementQuantum PhysicsLaserAtomic and Molecular Physics and Opticslaw.inventionFinesseResonatorlawPhysics::Accelerator PhysicsAtomic physicsQuantum Physics (quant-ph)
researchProduct

Experimental Quantum Probing Measurements With No Knowledge on the System-Probe Interaction

2020

In any natural science, measurements are the essential link between theory and observable reality. Is it possible to obtain accurate and relevant information via measurement whose action on the probed system is unknown? In other words, can one be convinced to know something about the nature without knowing in detail how the information was obtained? In this paper, we show that the answer is surprisingly, yes. We construct and experimentally implement a quantum optical probing measurement where measurements on the probes, the photons' polarization states, are used to extract information on the systems, the frequency spectra of the same photons. Unlike the pre-existing probing protocols, our …

PhysicsQuantum PhysicsPhotonfotonitmittausFOS: Physical sciencesObservablePolarization (waves)01 natural sciences010305 fluids & plasmasOptical probing0103 physical sciencesStatistical physicsQuantum Physics (quant-ph)010306 general physicskvanttifysiikkakvantti-informaatioRelevant informationQuantum
researchProduct

Backaction-evading measurement of entanglement in optomechanics

2019

We propose here a fully backaction-evading scheme for the measurement of the entanglement between two nanomechanical resonators. The system, which consists of two mechanical oscillators, coupled to a single mode of an electromagnetic resonant cavity through a radiation-pressure interaction term, is driven by two pump tones and four detection tones. As previously discussed in the literature, the former induce entanglement between the two mechanical oscillators, while we show here that a specific choice of phase and amplitude of the detection tones allows for direct pairwise reconstruction of the collective quadrature fluctuations of the mechanical oscillators belonging to quantum-mechanics-f…

PhysicsQuantum PhysicsSingle-mode optical fiberPhase (waves)FOS: Physical sciencesQuantum entanglementResonant cavity01 natural sciencesoskillaattorit010305 fluids & plasmasQuadrature (mathematics)optomechanicsentanglement detectionResonatorAmplitudenanorakenteetQuantum mechanics0103 physical scienceskvanttimekaniikka010306 general physicsQuantum Physics (quant-ph)Optomechanics
researchProduct

Domain-wall excitations in the two-dimensional Ising spin glass

2018

The Ising spin glass in two dimensions exhibits rich behavior with subtle differences in the scaling for different coupling distributions. We use recently developed mappings to graph-theoretic problems together with highly efficient implementations of combinatorial optimization algorithms to determine exact ground states for systems on square lattices with up to $10\,000\times 10\,000$ spins. While these mappings only work for planar graphs, for example for systems with periodic boundary conditions in at most one direction, we suggest here an iterative windowing technique that allows one to determine ground states for fully periodic samples up to sizes similar to those for the open-periodic…

PhysicsQuantum PhysicsSpin glassStatistical Mechanics (cond-mat.stat-mech)SpinsPhase (waves)FOS: Physical sciencesDisordered Systems and Neural Networks (cond-mat.dis-nn)Condensed Matter - Disordered Systems and Neural NetworksComputational Physics (physics.comp-ph)01 natural sciences010305 fluids & plasmasTheoretical physicsDomain wall (magnetism)Spin wave0103 physical sciencesCombinatorial optimizationIsing spinQuantum Physics (quant-ph)010306 general physicsPhysics - Computational PhysicsCritical exponentCondensed Matter - Statistical MechanicsPhysical Review B
researchProduct

Hyperfine level structure in nitrogen-vacancy centers near the ground-state level anticrossing

2019

Energy levels of nitrogen-vacancy centers in diamond were investigated using optically detected magnetic-resonance spectroscopy near the electronic ground-state level anticrossing (GSLAC) at an axial magnetic field around 102.4~mT in diamond samples with a nitrogen concentration of 1~ppm and 200~ppm. By applying radiowaves in the frequency ranges from 0 to 40 MHz and from 5.6 to 5.9 GHz, we observed transitions that involve energy levels mixed by the hyperfine interaction. We developed a theoretical model that describes the level mixing, transition energies, and transition strengths between the ground-state sublevels, including the coupling to the nuclear spin of the NV center\textquotesing…

PhysicsQuantum PhysicsSpinsCondensed Matter - Mesoscale and Nanoscale PhysicsDiamondFOS: Physical sciences02 engineering and technologyengineering.material021001 nanoscience & nanotechnologyPolarization (waves)7. Clean energy01 natural sciencesSpectral line3. Good healthVacancy defect0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)engineeringAtomic physics010306 general physics0210 nano-technologySpectroscopyGround stateQuantum Physics (quant-ph)Hyperfine structure
researchProduct

Spontaneous symmetry breaking as a resource for noncritically squeezed light

2010

[EN] In the last years we have proposed the use of the mechanism of spontaneous symmetry breaking with the purpose of generating perfect quadrature squeezing. Here we review previous work dealing with spatial (translational and rotational) symmetries, both on optical parametric oscillators and four-wave mixing cavities, as well as present new results. We then extend the phenomenon to the polarization state of the signal field, hence introducing spontaneous polarization symmetry breaking. Finally we propose a Jaynes-Cummings model in which the phenomenon can be investigated at the singlephoton-pair level in a non-dissipative case, with the purpose of understanding it from a most fundamental …

PhysicsQuantum PhysicsSqueezed statesSpontaneous symmetry breakingFOS: Physical sciencesOptical parametric oscillatorsSignal fieldSymmetry breakingPolarization (waves)Spontaneous polarizationQuantum mechanicsFISICA APLICADAHomogeneous spaceFour-wave mixing cavitiesSymmetry breakingQuantum Physics (quant-ph)Squeezed coherent stateParametric statistics
researchProduct

Steady-state generation of negative-Wigner-function light using feedback

2016

We propose a method of producing steady-state coherent light with negative Wigner functions in nonlinear media combined with feedback control. While the nonlinearities are essential to produce the Wigner negativities, this alone is insufficient to stabilize steady-state light with negativities. Using feedback control to control the phase in the cavity, we find that this produces significant total negativities for reasonable experimental parameters. The negative Wigner function is produced continuously and does not appear to be restricted to low-amplitude light. The technique is applicable to systems such as exciton-polaritons, where strong natural nonlinearities are present.

PhysicsQuantum PhysicsSteady state (electronics)business.industryFeedback controlPhase (waves)FOS: Physical sciences02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesNonlinear systemOpticsQuantum Gases (cond-mat.quant-gas)Quantum mechanics0103 physical sciencesWigner distribution function010306 general physics0210 nano-technologybusinessCondensed Matter - Quantum GasesQuantum Physics (quant-ph)
researchProduct

Superluminal two-color light in multiple Raman gain medium

2014

We investigate theoretically the formation of two-component light with superluminal group velocity in a medium controlled by four Raman pump fields. In such an optical scheme only a particular combination of the probe fields is coupled to the matter and exhibits superluminal propagation, the orthogonal combination is uncoupled. The individual probe fields do not have a definite group velocity in the medium. Calculations demonstrate that this superluminal component experiences an envelope advancement in the medium with respect to the propagation in vacuum.

PhysicsQuantum PhysicsSuperluminal motionbusiness.industryFOS: Physical sciencesInterference (wave propagation)Raman gainAtomic and Molecular Physics and OpticsOpticsQuantum Gases (cond-mat.quant-gas)Group velocityQuantum Physics (quant-ph)businessPhase conjugationCondensed Matter - Quantum GasesOptics (physics.optics)Raman pumpEnvelope (waves)Physics - Optics
researchProduct

All-Optical Storage of Phase-Sensitive Quantum States of Light.

2019

We experimentally demonstrate storage and on-demand release of phase-sensitive, photon-number superposition states of the form $\alpha |0\rangle + \beta e^{i\theta} |1\rangle$ for an optical quantized oscillator mode. For this purpose, we introduce a phase-probing mechanism to a storage system composed of two concatenated optical cavities, which was previously employed for storage of phase-insensitive single-photon states [Phys. Rev. X 3, 041028 (2013)]. This is the first demonstration of all-optically storing highly nonclassical and phase-sensitive quantum states of light. The strong nonclassicality of the states after storage becomes manifest as a negative region in the corresponding Wign…

PhysicsQuantum Physicsbusiness.industryPhase (waves)FOS: Physical sciencesGeneral Physics and AstronomyOptical storage01 natural sciencesSuperposition principleQuantum statePhase spaceQuantum mechanicsQubit0103 physical sciencesComputer data storageWigner distribution functionQuantum Physics (quant-ph)010306 general physicsbusinessPhysical review letters
researchProduct

Measurement of the transverse polarization ofΛandΛ¯hyperons produced in proton-proton collisions ats=7  TeVusing the ATLAS detector

2015

The transverse polarization of Λ and Λ¯ hyperons produced in proton-proton collisions at a center-of-mass energy of 7 TeV is measured. The analysis uses 760  μb−1 of minimum bias data collected by the ATLAS detector at the LHC in the year 2010. The measured transverse polarization averaged over Feynman xF from 5×10−5 to 0.01 and transverse momentum pT from 0.8 to 15 GeV is −0.010±0.005(stat)±0.004(syst) for Λ and 0.002±0.006(stat)±0.004(syst) for Λ¯. It is also measured as a function of xF and pT, but no significant dependence on these variables is observed. Prior to this measurement, the polarization was measured at fixed-target experiments with center-of-mass energies up to about 40 GeV. …

PhysicsQuantum chromodynamicsNuclear and High Energy PhysicsParticle physicsLarge Hadron ColliderExtrapolationHyperonParticle acceleratorPolarization (waves)7. Clean energylaw.inventionNuclear physicssymbols.namesakeTransverse planelawsymbolsFeynman diagramHigh Energy Physics::ExperimentNuclear ExperimentPhysical Review D
researchProduct