Search results for "zur"

showing 10 items of 321 documents

Clinical Predictors of Response to Magnetic Seizure Therapy in Depression

2019

Objectives Magnetic seizure therapy (MST) is a novel convulsive brain stimulation method in clinical testing, which is used as an alternative for electroconvulsive therapy in patients with treatment-resistant depression (TRD). Preliminary studies have suggested that MST leads to fewer cognitive adverse effects than electroconvulsive therapy but has similar efficacy. However, the clinical predictors of response to MST have not been evaluated yet. This study aimed to investigate whether these predictors can be identified in patients with TRD. Methods Thirty-eight patients with TRD were included. As clinical predictors for treatment response, we used the diagnosis, sex, age, family history, an…

AdultMalemedicine.medical_specialtyAnhedoniaMagnetic Field Therapymedicine.medical_treatmentNeuroscience (miscellaneous)Depressive Disorder Treatment-Resistant03 medical and health sciences0302 clinical medicineElectroconvulsive therapyPredictive Value of TestsSeizuresInternal medicinemedicineHumansFamily historyAtypical depressionDepression (differential diagnoses)AgedPsychiatric Status Rating ScalesDepressionbusiness.industryHamilton Rating Scale for DepressionMiddle Agedmedicine.disease030227 psychiatryPsychiatry and Mental healthTreatment OutcomeMagnetic seizure therapyBrain stimulationAnxietyFemalemedicine.symptombusinesshuman activities030217 neurology & neurosurgeryThe Journal of ECT
researchProduct

Effects of magnetic seizure therapy on anterograde and retrograde amnesia in treatment‐resistant depression

2019

Background Electroconvulsive therapy (ECT) is the gold standard for treatment-resistant depression (TRD). However, cognitive side effects, mainly anterograde and retrograde amnesia, frequently occur. Magnetic seizure therapy (MST) is tested using more focal seizure induction. However, the suggestion MST may be more beneficial than ECT because it causes fewer amnesia have not yet been comprehensively investigated using common neuropsychological testing specifically for ECT. We aimed to examine whether MST causes anterograde and retrograde amnesia. Methods Ten patients with TRD were treated with MST (8.9 [2] treatments) at 100% machine output, a frequency of 100 Hz and 657.4 (62) pulses per t…

AdultMalemedicine.medical_specialtyAnterograde amnesiamedicine.medical_treatmentAmnesiaNeuropsychological TestsAudiologybehavioral disciplines and activitiesDepressive Disorder Treatment-ResistantExecutive Function03 medical and health sciences0302 clinical medicineElectroconvulsive therapySeizuresmental disordersmedicineHumansElectroconvulsive Therapymedicine.diagnostic_testbusiness.industryRetrograde amnesiaNeuropsychological testMiddle AgedAmnesia Anterogrademedicine.disease030227 psychiatryPsychiatry and Mental healthClinical PsychologyMagnetic FieldsMagnetic seizure therapyBrain stimulationMental RecallAmnesia RetrogradeFemalemedicine.symptombusinesshuman activitiesTreatment-resistant depression030217 neurology & neurosurgeryDepression and Anxiety
researchProduct

Mortality in the first 30 days following incident acute symptomatic seizures.

2005

Purpose: Very little is known about short-term mortality after acute symptomatic seizure. One study found an increased mortality in the first year after acute symptomatic seizure, like mortality following acute symptomatic status epilepticus. Methods: We studied mortality in the first 30 days after an acute symptomatic seizure in two cohorts. In Washington Heights, New York City, we reviewed the medical records of all adults aged 20 years and older seen at Columbia Presbyterian Medical Center from January 1, 1990 through December 13, 1994 to identify incident acute symptomatic seizure. In Rochester, Minnesota, the medical records of all Rochester residents were reviewed to identify incident…

AdultMalemedicine.medical_specialtyPediatricsMinnesotaComorbidityCohort StudiesEpilepsyCause of DeathCase fatality ratemedicineHumansMortalityCause of deathAgedEpilepsybusiness.industryIncidence (epidemiology)IncidenceSymptomatic seizuresMiddle Agedmedicine.diseaseSurgeryStandardized mortality ratioNeurologyAcute DiseaseEtiologyFemaleNew York CityNeurology (clinical)businessCohort studyFollow-Up StudiesEpilepsia
researchProduct

Depression during an acute episode of schizophrenia or schizophreniform disorder and its impact on treatment response

2008

The aim of the present study was to examine the relevance of depressive symptoms during an acute schizophrenic episode for the prediction of treatment response. Two hundred inpatients who fulfilled DSM-IV criteria for schizophrenia or schizophreniform disorders were assessed at hospital admission and after 6 weeks of inpatient treatment using the Positive and Negative Syndrome Scale (PANSS) and the Hamilton Rating Scale for Depression (HAM-D). Depressive symptoms showed positive correlations with both positive and negative symptoms at admission and after 6 weeks, and decreased during 6 weeks of treatment. Pronounced depressive symptoms (HAM-D score> or =16) were found in 28% of the sample a…

AdultMalemedicine.medical_specialtyPsychosis610 Medicine & healthComorbidity10056 Clinic for Clinical and Social Psychiatry Zurich West (former)law.invention2738 Psychiatry and Mental Health03 medical and health sciencesPatient Admission0302 clinical medicineRandomized controlled triallawInternal medicinemental disordersmedicineHumansSchizophreniform disorderPsychiatryBiological PsychiatryDepression (differential diagnoses)ProbabilityPsychiatric Status Rating ScalesDepressive DisorderDepressive Disorder MajorPsychotropic DrugsPositive and Negative Syndrome ScaleHamilton Rating Scale for Depressionmedicine.diseaseComorbidity030227 psychiatryDiagnostic and Statistical Manual of Mental DisordersHospitalizationPsychiatry and Mental healthTreatment OutcomePsychotic DisordersSchizophreniaAcute DiseaseSchizophreniaFemaleSchizophrenic PsychologyPsychology2803 Biological Psychiatry030217 neurology & neurosurgeryAntipsychotic AgentsFollow-Up Studies
researchProduct

Acute symptomatic seizures in cerebral venous thrombosis

2020

© 2020 American Academy of Neurology

AdultMalemedicine.medical_specialtySubarachnoid hemorrhageInfarction030204 cardiovascular system & hematology03 medical and health sciences0302 clinical medicineModified Rankin ScaleRisk FactorsSeizuresInternal medicinemedicineHumans030212 general & internal medicineStrokeIntracerebral hemorrhageVenous Thrombosisbusiness.industrycerebral venous thrombosisSymptomatic seizuresOdds ratioMiddle Agedmedicine.diseaseThrombosisCerebral Veins3. Good healthVenous thrombosisAnesthesiaSettore MED/26 - NeurologiaFemaleNeurology (clinical)Intracranial Thrombosisbusiness030217 neurology & neurosurgery
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Insight into epileptic and physiological déjà vu: from a multicentric cohort study

2019

Background and purpose The presence of a continuum between physiological deja vu (DV) and epileptic DV is still not known as well as epidemiological data in the Italian population. The aim was to identify the epidemiological distribution of DV in Italy, and secondly to look for specific features of DV able to discriminate between epileptic and non-epileptic DV. Methods In all, 1000 individuals, 543 healthy controls (C) (313 women; age 40 ± 15 years) and 457 patients with epilepsy (E) (260 women; age 39 ± 14 years), were prospectively recruited from 10 outpatient neurological clinics throughout Italy. All populations were screened using the Italian Inventory for Deja Vu Experiences Assessmen…

AdultMalemedicine.medical_specialtymedia_common.quotation_subjectNeurocognitive Disordersepilepsy; epileptic déjà vu; physiological déjà vu; Adult; Cohort Studies; Epilepsy; Female; Humans; Italy; Male; Middle Aged; Neurocognitive Disorders; Recognition Psychology; Deja VuCohort Studies03 medical and health sciencesEpilepsy0302 clinical medicineEpidemiologyHumansPsychologyMedicine030212 general & internal medicinePsychiatrymedia_commonbusiness.industryphysiological déjà vuRecognition PsychologyMiddle AgedDeja Vumedicine.diseaseItalian populationepileptic déjà vuRecognitionItalyNeurologyFeelingDéjà vuEtiologyepilepsyFemaleNeurology (clinical)Epileptic seizuremedicine.symptombusiness030217 neurology & neurosurgeryCohort study
researchProduct

Rapid-rate transcranial magnetic stimulation of left dorsolateral prefrontal cortex in drug-resistant depression.

1996

Summary Background Lesion and neuroimaging studies suggest that left prefrontal lobe dysfunction is pathophysiologically linked to depression. Rapid-rate transcranial magnetic stimulation (rTMS) to prefrontal structures has a lateralised effect on mood in normal volunteers, and several preliminary studies suggest a beneficial effect of rTMS on depression. However, adequately controlled studies have not been conducted. Methods We have studied the effects of focal rTMS on the depressive symptoms in 17 patients with medication-resistant depression of psychotic subtype. The study was designed as a multiple cross-over, randomised placebo-controlled trial. Sham rTMS and stimulation of different c…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentDrug ResistancePrefrontal CortexStimulationElectric Stimulation TherapyAudiologybehavioral disciplines and activitiesElectroconvulsive therapyNeuroimagingSurveys and Questionnairesmental disordersmedicineHumansPsychiatryPrefrontal cortexDepression (differential diagnoses)Depressive DisorderCross-Over Studiesbusiness.industryGeneral MedicineMiddle AgedTranscranial Magnetic StimulationTranscranial magnetic stimulationMoodMagnetic seizure therapyFemalebusinessLancet (London, England)
researchProduct

Degree of Postictal Suppression Depends on Seizure Induction Time in Magnetic Seizure Therapy and Electroconvulsive Therapy.

2017

OBJECTIVES Anesthesia is required for both magnetic seizure therapy (MST) and electroconvulsive therapy (ECT), although it has anticonvulsant properties. In this case, bispectral index (BIS) monitoring, a specific electroencephalogram-derived monitoring, can be used to find the optimal seizure induction time during anesthesia to elicit adequate seizures. A measurement of seizure adequacy in electroencephalogram is the postictal suppression. The purpose of this study was to investigate the influence of seizure induction time on the degree of postictal suppression by comparing BIS versus no-BIS monitoring in MST and ECT. METHODS Twenty patients with treatment-resistant depression were randoml…

AdultMalemedicine.medical_treatmentNeuroscience (miscellaneous)law.invention03 medical and health sciencesDepressive Disorder Treatment-Resistant0302 clinical medicineElectroconvulsive therapyConsciousness MonitorsElectromagnetic FieldsRandomized controlled triallawPredictive Value of TestsSeizuresmedicineHumansAnesthesiaProspective StudiesElectroconvulsive TherapyAgedPsychiatric Status Rating ScalesCross-Over Studiesbusiness.industryElectroencephalographyMiddle AgedCrossover study030227 psychiatryPsychiatry and Mental healthAnticonvulsantTreatment OutcomeMagnetic seizure therapyBispectral indexAnesthesiaBrain stimulationFemaleAnalysis of variancebusinesshuman activities030217 neurology & neurosurgeryThe journal of ECT
researchProduct

Ictal functional TCD for the lateralization of the seizure onset zone—a report of two cases

2004

Ictal functional transcranial Doppler sonography (I-fTCD) was used to lateralize the ictal onset zone in the presurgical evaluation of two patients with temporal lobe epilepsy. In one patient, I-fTCD and ictal SPECT were performed simultaneously during EEG-monitoring. In both patients, results were concordant with the ictal SPECT findings, PET and semiology. I-fTCD seems to be an interesting new method to non-invasively lateralize the seizure onset zone with high temporal resolution. I-fTCD and SPECT may give complementary information to lateralize the seizure onset zone.

AdultMiddle Cerebral Arterymedicine.medical_specialtyUltrasonography Doppler TranscranialElectroencephalographyIctal-Interictal SPECT Analysis by SPMFunctional LateralityNeurosurgical ProceduresLateralization of brain functionTemporal lobeCentral nervous system diseaseEpilepsySeizuresmedicineHumansIctalTomography Emission-Computed Single-Photonmedicine.diagnostic_testbusiness.industryElectroencephalographySemiologymedicine.diseasenervous system diseasesEpilepsy Temporal Lobenervous systemNeurologyAnesthesiaFemaleNeurology (clinical)RadiologybusinessEpilepsy Research
researchProduct