0000000000343411

AUTHOR

Giorgio Reggiardo

0000-0003-4237-6797

showing 5 related works from this author

Reduced-dose of doublet chemotherapy combined with anti-EGFR antibodies in vulnerable older patients with metastatic colorectal cancer: Data from the…

2022

Abstract Objectives To assess the toxicity patterns and effectiveness of doublet chemotherapy when administered at reduced doses of 20% (FOLFOX or FOLFIRI) in combination with anti-EGFR antibodies (cetuximab or panitumumab) in old, vulnerable patients with metastatic colorectal cancer (mCRC). Patients and methods We performed a retrospective observational study of RAS and BRAF wild-type, vulnerable patients aged ≥70 years with previously untreated mCRC. The primary endpoint was safety, and secondary endpoints were overall response rate (ORR), progression-free survival (PFS), and overall survival (OS). Results One hundred and eighteen patients were collected from 14 selected Italian centres.…

medicine.medical_specialtyReduced doseColorectal cancerLeucovorinCetuximabNeutropeniaGastroenterologyFOLFOXInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineClinical endpointHumansPanitumumabDoublet chemotherapyAnti-EGFRAgedCetuximabMetastatic colorectal cancerRectal Neoplasmsbusiness.industryPanitumumabAnti-EGFRs Doublet chemotherapy Metastatic colorectal cancer Reduced doses Vulnerable older patientsExanthemamedicine.diseaseRashVulnerable older patients.OncologyColonic NeoplasmsFOLFIRIFluorouracilGeriatrics and Gerontologymedicine.symptomColorectal Neoplasmsbusinessmedicine.drugJournal of Geriatric Oncology
researchProduct

Cost-effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post hoc analysis of SMI…

2013

Claudio Borghi,1 Ettore Ambrosioni,1 Stefano Omboni,2 Arrigo FG Cicero,1 Stefano Bacchelli,1 Daniela Degli Esposti,1 Salvatore Novo,3 Dragos Vinereanu,4 Giuseppe Ambrosio,5 Giorgio Reggiardo,6 Dario Zava7 1Unit of Internal Medicine, Policlinico S Orsola, University of Bologna, Bologna, Italy; 2Italian Institute of Telemedicine, Varese, Italy; 3Division of Cardiology, University of Palermo, Palermo, Italy; 4University and Emergency Hospital, Bucharest, Romania; 5Division of Cardiology, University of Perugia, Perugia, Italy; 6Mediservice, Milano, Italy; 7Istituto Lusofarmaco d'Italia SpA, Peschiera Borromeo, Italy Background: In SMILE-4 (the Survival of Myocardial Infarction Long-term…

Ramiprilmedicine.medical_specialtyCost effectivenessEconomics Econometrics and Finance (miscellaneous)Populationacute myocardial infarctionramiprilchemistry.chemical_compoundInternal medicinePost-hoc analysismedicinezofenoprilMyocardial infarctioneducationcost-effectivenesshealth care economics and organizationsOriginal Researchleft ventricular dysfunctioneducation.field_of_studylcsh:R5-920business.industryHealth Policylcsh:RM1-950acetylsalicylic acidmedicine.diseaseSMILE studycost effectiveness analysis (CEA)Confidence intervalZofenoprilangiotensin-converting enzyme inhibitorsClinicoEconomics and Outcomes Researchlcsh:Therapeutics. PharmacologychemistryCardiologyNumber needed to treatMedical emergencybusinesslcsh:Medicine (General)medicine.drug
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Reference values of blood cell counts in the first days of life

2011

The lack of updated neonatal reference values for hematological parameters impacts significantly with clinical management of both healthy and sick newborns. The present pilot study was thus aimed at assessing updated hematological Italian reference values in late preterm and term newborns. From January 2004 to December 2008 hematological laboratory tests were performed in 1175 newborns (820 healthy and 355 sick controls) between 33-41 weeks of gestation, during the first four days after birth. Hematological parameters were sorted for gender and gestational age and statistically analyzed. No gender-related differences were observed at different weeks of gestation and no significant differenc…

MaleQuality Controlmedicine.medical_specialtyPediatricsLate-pretermGeneral Biochemistry Genetics and Molecular BiologyBlood cellSettore MED/38 - Pediatria Generale E SpecialisticaReference ValuesBlood cell countsWhite blood cellmedicineLate pretermHumansHematological parametersNewbornsGeneral Immunology and MicrobiologyObstetricsbusiness.industryInfant NewbornGestational ageHematological parameters; Late-preterm; Newborns; Reference curveBlood Cell Countmedicine.anatomical_structureSample SizeReference valuesGestationPopulation studyFemaleReference curvebusinessFrontiers in Bioscience
researchProduct

P-42 Reduced-dose of doublet chemotherapy combined with anti-EGFR antibodies as treatment option in vulnerable older patients with metastatic colorec…

2021

Oncologymedicine.medical_specialtyChemotherapybiologybusiness.industryColorectal cancermedicine.medical_treatmentTreatment optionsRetrospective cohort studyHematologymedicine.diseaseReduced doseOncologyOlder patientsInternal medicinebiology.proteinMedicineAntibodybusinessAnnals of Oncology
researchProduct