0000000000343826

AUTHOR

Justus Marquetand

showing 2 related works from this author

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Reliability of Magnetoencephalography and High-Density Electroencephalography Resting-State Functional Connectivity Metrics

2019

Resting-state connectivity, for example, based on magnetoencephalography (MEG) or electroencephalography (EEG), is a widely used method for characterizing brain networks and a promising imaging biomarker. However, there is no established standard as to which method, modality, and analysis variant is preferable and there is only limited knowledge on the reproducibility, an important prerequisite for clinical application. We conducted an MEG-/ high-density (hd)-EEG-study on 22 young healthy adults, who were measured twice in a scan/rescan design after 7 – 2 days. Reliability of resting-state (15 min, eyes-closed) connectivity in source space was calculated via intraclass correlation coefficie…

AdultMaleComputer scienceRestHigh densityElectroencephalography050105 experimental psychology03 medical and health sciences0302 clinical medicineNeural PathwaysConnectomemedicineHumans0501 psychology and cognitive sciencesResting stateReliability (statistics)Brain MappingConnectivityMEGmedicine.diagnostic_testResting state fMRIbusiness.industryGeneral NeuroscienceFunctional connectivity05 social sciencesBrainMagnetoencephalographyReproducibility of ResultsElectroencephalographyPattern recognitionMagnetoencephalographyReliabilityMagnetic Resonance ImagingHealthy Volunteersddc:616.8BenchmarkingFemalehd-EEGArtificial intelligenceNerve NetbusinessAlgorithms030217 neurology & neurosurgeryBrain Connectivity
researchProduct