0000000000369140

AUTHOR

Tao Huang

showing 8 related works from this author

Association of Birth Weight With Type 2 Diabetes and Glycemic Traits: A Mendelian Randomization Study.

2019

Key Points Question Is birth weight associated with type 2 diabetes and glycemic traits? Findings This mendelian randomization study found that a 1-SD decrease in birth weight due to the genetic risk score was associated with a higher risk of type 2 diabetes among European and East Asian populations. In addition, a 1-SD decrease in birth weight was associated with a 0.189-SD increase in fasting glucose concentration, but not with fasting insulin, 2-hour glucose, or hemoglobin A1c level. Meaning A genetic predisposition to lower birth weight was associated with an increased risk of type 2 diabetes and increased fasting glucose, suggesting potential mechanisms through which perturbation of th…

Blood GlucoseMaleType 2 diabetes0302 clinical medicineOdds RatioBirth WeightInsulin030212 general & internal medicineOriginal Investigation0303 health sciencesAsia EasternMendelian Randomization AnalysisGeneral MedicineMiddle Aged16. Peace & justice3. Good healthOnline OnlyDiabetes and EndocrinologyFemaletype 2 diabetesAdultmedicine.medical_specialtyDiabetes riskAdolescentBirth weightPolymorphism Single NucleotideWhite People03 medical and health sciencesYoung AdultSDG 3 - Good Health and Well-beingAsian PeopleDiabetes mellitusInternal medicineMendelian randomizationmedicineHumans030304 developmental biologyGlycemicAgedGlycated Hemoglobinbusiness.industryResearchInfant Newbornbirth weightGenetic VariationOdds ratioMendelian Randomization Analysismedicine.diseaseDiabetes Mellitus Type 2mendelian randomization studybusinessJAMA network open
researchProduct

Interaction of Diet/Lifestyle Intervention and TCF7L2 Genotype on Glycemic Control and Adiposity among Overweight or Obese Adults: Big Data from Seve…

2021

Objective . The strongest locus which associated with type 2 diabetes (T2D) by the common variant rs7903146 is the transcription factor 7-like 2 gene ( TCF7L2 ). We aimed to quantify the interaction of diet/lifestyle interventions and the genetic effect of TCF7L2 rs7903146 on glycemic traits, body weight, or waist circumference in overweight or obese adults in several randomized controlled trials (RCTs). Methods . From October 2016 to May 2018, a large collaborative analysis was performed by pooling individual-participant data from 7 RCTs. These RCTs reported changes in glycemic control and adiposity of the variant rs7903146 after dietary/lifestyle-related interventions in overweight or ob…

medicine.medical_specialtyendocrine system diseasesbusiness.industryComputer applications to medicine. Medical informaticsR858-859.7nutritional and metabolic diseasesOverweightlaw.inventionRandomized controlled triallawInternal medicineGenotypeLifestyle interventionMedicinemedicine.symptombusinessTCF7L2GlycemicHealth Data Science
researchProduct

Timing of Exercise Affects Glycemic Control in Type 2 Diabetes Patients Treated with Metformin

2018

Objective. The purpose of the study was to examine the acute effects of the timing of exercise on the glycemic control during and after exercise in T2D. Methods. This study included 26 T2D patients (14 women and 12 men) who were treated with metformin. All patients were tested on four occasions: metformin administration alone (Metf), high-intensity interval training (HIIT) performed at 30 minutes (EX30), 60 minutes (EX60), and 90 minutes (EX90) postbreakfast, respectively. Glucose, insulin, and superoxide dismutase (SOD) activity were examined. Results. Glucose decreased significantly after the exercise in EX30, EX60, and EX90. Compared with Metf, the decline in glucose immediately after th…

Blood GlucoseMaleTime Factorsendocrine system diseasesEndocrinology Diabetes and Metabolismmedicine.medical_treatmentmetformiiniajoitus (suunnittelu)Type 2 diabetes030204 cardiovascular system & hematologyHigh-Intensity Interval TrainingGastroenterologylcsh:Diseases of the endocrine glands. Clinical endocrinologyInterval training0302 clinical medicineEndocrinologyInsulinta315type 2 diabetes patientskuntoliikuntata3141Middle Agedtiming of exerciseMetforminFemaleHigh-intensity interval trainingmedicine.drugAdultmedicine.medical_specialtyArticle Subject030209 endocrinology & metabolism03 medical and health sciencesInternal medicineDiabetes mellitusmedicineHumansHypoglycemic AgentsExercise physiologyExerciseGlycemiclcsh:RC648-665business.industrySuperoxide DismutaseInsulinmedicine.diseaseDiabetes Mellitus Type 2verensokeriClinical Studyglycemic controlbusinessmetforminaikuistyypin diabetesJournal of Diabetes Research
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of >…

Malemedicine.medical_specialtyChinaAdolescentUniversitiesPhysical fitnessPhysical activityIdeal Body Weight030209 endocrinology & metabolismBody-mass indexBody fat percentageBody compositionBody Mass Index03 medical and health sciencesYoung AdultSkeletal muscle mass0302 clinical medicineEpidemiologymedicineHumans030212 general & internal medicineObesityAssociation (psychology)Muscle SkeletalStudents2. Zero hungerPublic healthbusiness.industryPhysical activity4. Educationlcsh:Public aspects of medicinePublic Health Environmental and Occupational Healthlcsh:RA1-1270Test (assessment)Normal weight obesityPhysical FitnessFemalebusinessBody mass indexDemographyResearch ArticleBMC Public Health
researchProduct

Genome Analyses of >200,000 Individuals Identify 58 Loci for Chronic Inflammation and Highlight Pathways that Link Inflammation and Complex Disorders

2018

International audience; C-reactive protein (CRP) is a sensitive biomarker of chronic low-grade inflammation and is associated with multiple complex diseases. The genetic determinants of chronic inflammation remain largely unknown, and the causal role of CRP in several clinical outcomes is debated. We performed two genome-wide association studies (GWASs), on HapMap and 1000 Genomes imputed data, of circulating amounts of CRP by using data from 88 studies comprising 204,402 European individuals. Additionally, we performed in silico functional analyses and Mendelian randomization analyses with several clinical outcomes. The GWAS meta-analyses of CRP revealed 58 distinct genetic loci (p < 5 × 1…

0301 basic medicineMaleNetherlands Twin Register (NTR)Bipolar DisorderLD SCORE REGRESSION[SDV]Life Sciences [q-bio]Genome-wide association study[SDV.GEN] Life Sciences [q-bio]/GeneticsBody Mass Indexinflammatory disorder80 and overWIDE ASSOCIATIONEPIDEMIOLOGYta318International HapMap ProjectChildGenetics (clinical)2. Zero hungerGeneticsGenetics & HeredityAged 80 and over[SDV.MHEP] Life Sciences [q-bio]/Human health and pathologyC-reactive proteingenome-wide association studyinflammationMendelian randomizationinflammatory disordersDEPICTcoronary artery diseaseschizophreniasystem biologysystem biologyDEPICTMendelian Randomization Analysis11 Medical And Health SciencesMiddle AgedC-reactive protein; coronary artery disease; DEPICT; genome-wide association study; inflammation; inflammatory disorders; Mendelian randomization; schizophrenia; system biology; Adolescent; Adult; Aged; Aged 80 and over; Biomarkers; Bipolar Disorder; Body Mass Index; C-Reactive Protein; Child; Female; Genetic Loci; Genome-Wide Association Study; Humans; Inflammation; Liver; Male; Mendelian Randomization Analysis; Metabolic Networks and Pathways; Middle Aged; Schizophrenia; Young Adult3. Good health[SDV] Life Sciences [q-bio]LiverMedical geneticsBiomarker (medicine)/dk/atira/pure/sustainabledevelopmentgoals/good_health_and_well_beingFemaleinflammatory disordersLife Sciences & BiomedicineMetabolic Networks and Pathwayscoronary artery diseaseHumanAdultmedicine.medical_specialtyAdolescentCHARGE Inflammation Working GroupC-reactive protein ; DEPICT ; Mendelian randomization ; coronary artery disease ; genome-wide association study ; inflammation ; inflammatory disorders ; schizophrenia ; system biologyBiologyIMMUNITYta3111ArticleC-reactive protein03 medical and health sciencesYoung AdultSDG 3 - Good Health and Well-beingMendelian randomizationGeneticsmedicine/dk/atira/pure/keywords/cohort_studies/netherlands_twin_register_ntr_Mendelian randomizationHumansCORONARY-HEART-DISEASEMendelian Randomization Analysi1000 Genomes ProjectMETAANALYSISGenetic associationAged[SDV.GEN]Life Sciences [q-bio]/GeneticsScience & Technologygenome-wide association studyta1184Metabolic Networks and PathwayBiomarkerINSTRUMENTS06 Biological SciencesMendelian Randomization Analysisschizophrenia030104 developmental biologyGenetic LociinflammationC-reactive protein; DEPICT; Mendelian randomization; coronary artery disease; genome-wide association study; inflammation; inflammatory disorders; schizophrenia; system biology[SDV.MHEP]Life Sciences [q-bio]/Human health and pathologyBiomarkersLifeLines Cohort Study
researchProduct

OR-039 Normal-weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Objective The primary aim of this study was to examine the associations of normal weight obesity with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass.&#x0D; Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by a bio-impedance device (InBody 720). NWO was defined by a BMI of 18.5 - 23.9 kg/m2 and a body fat percentage of …

Normal weight obesitybusiness.industryBody heightLeisure timePhysical fitnessPhysiologyMedicineHealth riskbusinessFemale studentsBody fat percentageShuttle run testExercise Biochemistry Review
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Additional file 1: of Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Participants characteristics stratified by gender and four weight group. (PDF 129 kb)

body regionsnervous systemfungi
researchProduct