0000000000640388

AUTHOR

D Degli Esposti

showing 2 related works from this author

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Zofenopril is a cost-effective treatment for patients with left ventricular systolic dysfunction following acute myocardial infarction: a pharmacoeco…

2013

Objective: The Survival of Myocardial Infarction Long-term Evaluation 4 Study (SMILE-4) showed the superiority of Zofenopril (Z) associated with Acetylsalicylic Acid (ASA) as respect to Ramipril (R) plus ASA in reducing the occurrence of major cardiovascular events, in patients with left ventricular dysfunction (LVD) following Acute Myocardial Infarction (AMI). The objective of this retrospective analysis was the evaluation of cost-effectiveness of Z compared to R. Methods: 771 patients with LVD and AMI were randomized, double-blind to Z 60 mg/day (n=389) or R 10 mg/day (n=382) plus ASA 100 mg/day and followed-up for 1 year. The primary study end-point was 1-year combined occurrence of deat…

RamiprilPediatricsmedicine.medical_specialtyeducation.field_of_studybusiness.industryCost effectivenessSurrogate endpointPopulationmedicine.diseaseConfidence intervalZofenoprilchemistry.chemical_compoundchemistryInternal medicinemedicineCardiologyNumber needed to treatMyocardial infarctionCardiology and Cardiovascular Medicinebusinesseducationhealth care economics and organizationsmedicine.drugEuropean Heart Journal
researchProduct