0000000000757759

AUTHOR

Henri Lyyra

showing 5 related works from this author

Experimental snapshot verification of non-Markovianity by quantum probing of convex coefficients

2022

We apply the recently proposed quantum probing protocols with an unknown system-probe coupling to probe the convex coefficients in mixtures of commuting states. By using two reference states instead of one as originally suggested, we are able to probe both the lower and upper bounds for the convex coefficient. We perform extensive analysis for the roles of the parameters characterizing the double peaked Gaussian frequency spectrum in the Markovian-to-non-Markovian transition of the polarization dynamics of a single photon. We apply the probing of the convex coefficient to the transition-inducing frequency parameter and show that the non-Markovianity of the polarization dynamics can be confi…

fotonitpolarisaatio (aaltoliike)kvantti-informaatiokvanttifysiikkaPhysical Review A
researchProduct

Experimental Quantum Probing Measurements With No Knowledge on the System-Probe Interaction

2020

In any natural science, measurements are the essential link between theory and observable reality. Is it possible to obtain accurate and relevant information via measurement whose action on the probed system is unknown? In other words, can one be convinced to know something about the nature without knowing in detail how the information was obtained? In this paper, we show that the answer is surprisingly, yes. We construct and experimentally implement a quantum optical probing measurement where measurements on the probes, the photons' polarization states, are used to extract information on the systems, the frequency spectra of the same photons. Unlike the pre-existing probing protocols, our …

PhysicsQuantum PhysicsPhotonfotonitmittausFOS: Physical sciencesObservablePolarization (waves)01 natural sciences010305 fluids & plasmasOptical probing0103 physical sciencesStatistical physicsQuantum Physics (quant-ph)010306 general physicskvanttifysiikkakvantti-informaatioRelevant informationQuantum
researchProduct

Experimental realization of high-fidelity teleportation via non-Markovian open quantum system

2020

Open quantum systems and study of decoherence are important for our fundamental understanding of quantum physical phenomena. For practical purposes, there exists a large number of quantum protocols exploiting quantum resources, e.g. entanglement, which allows to go beyond what is possible to achieve by classical means. We combine concepts from open quantum systems and quantum information science, and give a proof-of-principle experimental demonstration -- with teleportation -- that it is possible to implement efficiently a quantum protocol via non-Markovian open system. The results show that, at the time of implementation of the protocol, it is not necessary to have the quantum resource in …

PhysicsQuantum PhysicsQuantum decoherenceFOS: Physical sciencesQuantum entanglementQuantum PhysicsTopology01 natural sciencesTeleportationOpen system (systems theory)010305 fluids & plasmasOpen quantum systemQubit0103 physical sciences010306 general physicsQuantum information scienceQuantum Physics (quant-ph)Quantum
researchProduct

The effects of ion implantation damage to photonic crystal optomechanical resonators in silicon

2021

Abstract Optomechanical resonators were fabricated on a silicon-on-insulator substrate that had been implanted with phosphorus donors. The resonators’ mechanical and optical properties were then measured (at 6 K and room temperature) before and after the substrate was annealed. All measured resonators survived the annealing and their mechanical linewidths decreased while their optical and mechanical frequencies increased. This is consistent with crystal lattice damage from the ion implantation causing the optical and mechanical properties to degrade and then subsequently being repaired by the annealing. We explain these effects qualitatively with changes in the silicon crystal lattice struc…

Materials scienceSiliconFOS: Physical sciencesPhysics::Opticschemistry.chemical_element02 engineering and technology01 natural sciencesCondensed Matter::Materials ScienceResonatorMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesion implantation010306 general physicsPhotonic crystalCondensed Matter - Materials ScienceCondensed Matter - Mesoscale and Nanoscale Physicsbusiness.industrytechnology industry and agricultureMaterials Science (cond-mat.mtrl-sci)silicon021001 nanoscience & nanotechnologyoptomechanicsIon implantationchemistryOptoelectronics0210 nano-technologybusinessnanomechanical resonatorphotonic crystalOptics (physics.optics)Physics - OpticsMaterials for Quantum Technology
researchProduct

Experimental realization of high-fidelity teleportation via a non-Markovian open quantum system

2020

Open quantum systems and study of decoherence are important for our fundamental understanding of quantum physical phenomena. For practical purposes, a large number of quantum protocols exist that exploit quantum resources, e.g., entanglement, which allows us to go beyond what is possible to achieve by classical means. We combine concepts from open quantum systems and quantum information science and give a proof-of-principle experimental demonstration-with teleportation-that it is possible to implement efficiently a quantum protocol via a non-Markovian open system. The results show that, at the time of implementation of the protocol, it is not necessary to have the quantum resource in the de…

Quantum Physicskvanttifysiikkakvantti-informaatio
researchProduct