0000000001317897

AUTHOR

Yuan Gao

showing 10 related works from this author

Negative pressure cavitation extraction and antioxidant activity of genistein and genistin from the roots of pigeon pea [Cajanus cajan (L.) Millsp.]

2010

Abstract A new method—negative pressure cavitation extraction (NPCE) was proposed and investigated for the extraction of the main isoflavonoids, namely genistein and genistin from pigeon pea roots. The effects of extraction time and particle size on the extraction yields were firstly optimized, then a central composite design (CCD) combined with response surface methodology (RSM) was used to study the effects of negative pressure, ethanol concentration and liquid/solid ratio on the extraction yields. The maximum extraction yields of genistein and genistin reached 0.418 and 0.398 mg/g, respectively, under the optimal conditions: extraction time 45 min, particle size 50 mesh, negative pressur…

ChromatographyCentral composite designbiologyDPPHExtraction (chemistry)GenisteinFiltration and Separationbiology.organism_classificationAnalytical Chemistrychemistry.chemical_compoundCajanuschemistryGenistinParticle sizeResponse surface methodologySeparation and Purification Technology
researchProduct

Characterization of five fungal endophytes producing Cajaninstilbene acid isolated from pigeon pea [Cajanus cajan (L.) Millsp].

2011

Five fungal endophytes (K4, K5, K6, K9, K14) producing Cajaninstilbene acid (CSA, 3-hydroxy-4-prenyl-5-methoxystilbene-2-carboxylic acid) were isolated from the roots of pigeon pea [Cajanus cajan (L.) Millsp.]. CSA is responsible for the prominent pharmacological activities in pigeon pea. The amount of CSA in culture solution varied among the five fungal endophytes. K4 produced the highest levels of CSA (1037.13 µg/L) among the endophytes tested after incubation for five days. Both morphological characteristics and molecular methods were used for species identification of fungal endophytes. The five endophytic isolates were characterized by analyzing the internal transcribed spacer (ITS) rR…

FusariumApplied Microbiologylcsh:MedicineMycologyPlant ScienceBiologyPlant RootsMicrobiologyCajanusPlant MicrobiologyCajanusFusariumTubulinBotanyFusarium oxysporumStilbenesEndophytesInternal transcribed spacerMedicinal plantslcsh:ScienceBiologyMicrobial MetabolismMultidisciplinarylcsh:RFungal geneticsFungiBotanyfood and beveragesRibosomal RNAbiology.organism_classificationSalicylatesFusariosisFungal ClassificationNeonectrialcsh:QResearch ArticleBiotechnologyPloS one
researchProduct

Geo-economic variations in epidemiology, patterns of care, and outcomes in patients with acute respiratory distress syndrome: insights from the LUNG …

2017

Background Little information is available about the geo-economic variations in demographics, management, and outcomes of patients with acute respiratory distress syndrome (ARDS). We aimed to characterise the effect of these geo-economic variations in patients enrolled in the Large Observational Study to Understand the Global Impact of Severe Acute Respiratory Failure (LUNG SAFE). Methods LUNG SAFE was done during 4 consecutive weeks in winter, 2014, in a convenience sample of 459 intensive-care units in 50 countries across six continents. Inclusion criteria were admission to a participating intensive-care unit (including transfers) within the enrolment window and receipt of invasive or non…

MaleARDSdemographyeconomicmedicine.medical_treatmentTerapéuticaair conditioningComorbidityintensive care unitdeveloped country0302 clinical medicineneuromuscular blockingmiddle agedacute myocardial-infarctionmiddle income countryProspective StudiesGeography Medicalcritically-ill patientsadultagedpriority journalrisk factorIncomegeographic-variationDeveloped countryhospitalizationprospective studyHumanPulmonary and Respiratory MedicineDeveloped Countriemedicine.medical_specialtyDeveloping countryArticle/dk/atira/pure/subjectarea/asjc/2700/274003 medical and health sciencesSíndrome respiratorio agudo graveunitsMedicalHumansIntensive care medicineDeveloping CountriesAgedhigh income countryRespiratory Distress Syndrome Adultnoninvasive ventilationAparato respiratoriomedicine.diseasemortalitymajor clinical studyProspective Studiearterial oxygen tension030228 respiratory systemARDSObservational studySociologíahealth care deliverygeographyintensive-careRisk FactorsEpidemiologyProspective cohort studyRespiratory Distress Syndromepartial pressureartificial ventilationSociología médicaMiddle Agedadult respiratory distress syndromeAged; Comorbidity; Delivery of Health Care; Developed Countries; Developing Countries; Europe; Female; Geography Medical; Humans; Income; Intensive Care Units; Male; Middle Aged; Patient Outcome Assessment; Prospective Studies; Respiratory Distress Syndrome Adult; Risk Factors; Pulmonary and Respiratory MedicineEuropeIntensive Care UnitsfemaleincomeFemaleEnfermedadinjurycohort analysigross national incomesurvivalNOmedical geographyDeveloping Countrielength of staymedicinecontrolled studyoutcome assessmentbreast-cancerMechanical ventilationdiseasebusiness.industryDeveloped Countriespatient caredeveloping country030208 emergency & critical care medicinestatistics and numerical data AgedComorbiditywinterACUTE MYOCARDIAL-INFARCTION; CRITICALLY-ILL PATIENTS; GEOGRAPHIC-VARIATION; INTENSIVE-CARE; BREAST-CANCER; MORTALITY; DISEASE; INJURY; UNITS; HOSPITALIZATIONPatient Outcome AssessmentEmergency medicineprone positiontreatment outcomebusinessDelivery of Health Care
researchProduct

Antioxidant properties, superoxide dismutase and glutathione reductase activities in HepG2 cells with a fungal endophyte producing apigenin from pige…

2012

Abstract A fungal endophyte MD89 with obvious antioxidant activities was isolated from pigeon pea and identified as Chaetomium globosum by ITS sequence. Different fractions from MD89 culture were compared and evaluated by total phenol (TP) content, total flavonoid (TFL) content, DPPH radical scavenging, reducing power and lipid peroxidation assays, respectively. Results showed that EtOAc extracts had high content of TP and TFL, and strong antioxidant activities (IC 50 value was 6.87, 15.19, 16.78 μg/mL, respectively). Furthermore, the EtOAc extracts were analyzed by LC–MS/MS and a good antioxidant compound, apigenin, was found. The activities of superoxide dismutase (SOD) and glutathione re…

chemistry.chemical_classificationAntioxidantbiologyDPPHmedicine.medical_treatmentGlutathione reductaseFlavonoidbiology.organism_classificationLipid peroxidationSuperoxide dismutasechemistry.chemical_compoundCajanuschemistryBiochemistryApigeninmedicinebiology.proteinFood scienceFood ScienceFood Research International
researchProduct

Cyanide-bridged coordination polymers constructed from lanthanide ions and octacyanometallate building-blocks

2018

A new series of cyanide-bridged assemblies, {KH[Ln2(2,3-pzdc)2(CH3OH)(H2O)7][M(CN)8]}·5H2O (Ln3+ = Nd, Gd, Tb, and Dy; M4+ = Mo and W), were synthesised by self-assembling lanthanide ions and octacyanometallate ions in the presence of pyrazine-2,3-dicarboxylic acid (2,3-H2pzdc). These compounds have a 3D structure in which octagon-like Ln4M4(CN)8 rings are connected through a second Ln3+ center via the carboxylate groups of one 2,3-pzdc. The resulting 1D channels are filled with K+ ions and lattice water molecules. The temperature and field dependent magnetization studies as well as ab initio calculations indicate weak ferromagnetic interactions between the Gd3+ ions within the GdMo compoun…

LanthanideMaterials science010405 organic chemistry010402 general chemistry01 natural sciences0104 chemical sciencesIonInorganic ChemistryMagnetizationchemistry.chemical_compoundMagnetic anisotropyCrystallographyFerromagnetismchemistryAb initio quantum chemistry methodsMoleculeCarboxylate
researchProduct

Dual inhibitors of histone deacetylases and other cancer-related targets: A pharmacological perspective.

2020

International audience; Epigenetic enzymes histone deacetylases (HDACs) are clinically validated anticancer drug targets which have been studied intensively in the past few decades. Although several drugs have been approved in this field, they are still limited to a subset of hematological malignancies (in particular T-cell lymphomas), with therapeutic potential not fully realized and the drug-resistance occurred after a certain period of use. To maximize the therapeutic potential of these classes of anticancer drugs, and to extend their application to solid tumors, numerous combination therapies containing an HDACi and an anticancer agent from other mechanisms are currently ongoing in clin…

0301 basic medicineDual targeting[SDV]Life Sciences [q-bio]Cancer therapyKinasesAntineoplastic AgentsBioinformaticsBiochemistryAnticancer drugsSynergistic effectsHistone Deacetylases03 medical and health sciences0302 clinical medicineDrug Delivery SystemsNeoplasmsReceptorsmedicineAnimalsHumansEpigeneticsPharmacologybiologybusiness.industryCancerDUAL (cognitive architecture)medicine.diseaseAnticancer drug3. Good healthEnzymesClinical trial[SDV] Life Sciences [q-bio]Histone Deacetylase Inhibitors030104 developmental biologyHistone030220 oncology & carcinogenesisbiology.proteinHistone deacetylases (HDACs)EpigeneticsDual inhibitorbusinessBiochemical pharmacology
researchProduct

Electrophysiological evidence for the effectiveness of images versus text in warnings

2023

AbstractWarning sign plays an important role in risk avoidance. Many studies have found that images are better warnings than text, while others have revealed flaws of image-only warning signs. To better understand the factors underlying the effectiveness of different types of warning signs (image only, text only, or image and text), this study adopted event-related potential technology to explore the differences at the neurocognitive level using the oddball paradigm and the Go/No-go paradigm. Together, the behavioral and electroencephalogram results showed that text-only warnings had the lowest effectiveness, but there was little difference between the image-only and image-and-text warnings…

cognitionkognitiowarningsMultidisciplinarytekstiteffectivenesselectrophysiologykognitiiviset prosessitattentionimageselektrofysiologiawarning signsmerkitEEGkognitiivinen neurotiedetarkkaavaisuusvaroitusmerkinnättextsERPcognitive processeskuvatScientific Reports
researchProduct

Immunocompromised patients with acute respiratory distress syndrome: Secondary analysis of the LUNG SAFE database

2018

Background: The aim of this study was to describe data on epidemiology, ventilatory management, and outcome of acute respiratory distress syndrome (ARDS) in immunocompromised patients. Methods: We performed a post hoc analysis on the cohort of immunocompromised patients enrolled in the Large Observational Study to Understand the Global Impact of Severe Acute Respiratory Failure (LUNG SAFE) study. The LUNG SAFE study was an international, prospective study including hypoxemic patients in 459 ICUs from 50 countries across 5 continents. Results: Of 2813 patients with ARDS, 584 (20.8%) were immunocompromised, 38.9% of whom had an unspecified cause. Pneumonia, nonpulmonary sepsis, and noncardiog…

MaleARDSmodelos logísticosDatabases Factualmedicine.medical_treatment[SDV]Life Sciences [q-bio]humanoslnfectious Diseases and Global Health Radboud Institute for Molecular Life Sciences [Radboudumc 4]Kaplan-Meier EstimateCritical Care and Intensive Care MedicineAcute respiratory failureSeverity of Illness IndexCohort Studiesrandomized-trial0302 clinical medicineMechanical ventilationRisk Factorsestudios prospectivosEpidemiology80 and overicuMedicineProspective StudiesProspective cohort studyestudios de cohortesImmunodeficiencymediana edadestadísticasAged 80 and overRespiratory Distress Syndromeancianocritically-ill patientsRespirationresultado del tratamientorespiraciónStatisticslcsh:Medical emergencies. Critical care. Intensive care. First aidadultoMiddle Aged3. Good healthfailureIntensive Care UnitsTreatment OutcomeArtificialCohortprospective multicenterImmunocompromised patientsAcute respiratory failure; ARDS; Immunocompromised patients; Mechanical ventilation; Noninvasive ventilation; Critical Care and Intensive Care MedicineFemaleNoninvasive ventilationHumanestimación de Kaplan-MeierAdultmedicine.medical_specialtyLogistic ModelIntensive Care UnitSocio-culturaleunidades de cuidados intensivossurvivalStatistics NonparametricSepsisDatabases03 medical and health sciencesImmunocompromised HostInternal medicineImmunocompromised patientcancerfactores de riesgoHumansNonparametricíndice de gravedad de la enfermedadintensive-care-unitFactualAgedMechanical ventilationbusiness.industryResearchRisk FactorRespiratory Distress Syndrome Adult030208 emergency & critical care medicinelcsh:RC86-88.9medicine.diseaseRespiration ArtificialPneumoniaProspective StudieLogistic Models030228 respiratory systemmalignanciesARDShuésped inmunodeprimidoCohort StudiebusinessAcute respiratory failure; ARDS; Immunocompromised patients; Mechanical ventilation; Noninvasive ventilation; Adult; Aged; Aged 80 and over; Cohort Studies; Databases Factual; Female; Humans; Intensive Care Units; Kaplan-Meier Estimate; Logistic Models; Male; Middle Aged; Prospective Studies; Respiration Artificial; Respiratory Distress Syndrome Adult; Risk Factors; Severity of Illness Index; Statistics Nonparametric; Treatment Outcome; Immunocompromised Host
researchProduct

Uncertainty analysis and symmetry restoration in nuclear self-consistent methods

2015

This thesis contains two articles, in the following denoted by I and II, and an introduction to them. In Chapter 1, I present the theoretical models of nuclear structure. In Chapter 2, I introduce the basic ideas about the density functional theory (DFT) and self-consistent mean-field (SCMF) calculations. In Chapter 3, I give the formulae for the uncertainty propagation, which is the error analysis method used in article I. As a proper tool to survey the predictive power of theoretical models, the error analysis now has become more and more widely used. By analyzing the propagation of uncertainties, one tries to find out the e ectiveness of the calculation with a given parameter set obtaine…

symmetriaydinrakenneenergiatiheysfunktionaalitnuclear density functional theorytiheysfunktionaaliteorianuclear structurepropagation of uncertaintyenergy-density-functionalssymmetry restorationmatemaattiset mallitydinfysiikkavirheanalyysi
researchProduct

CCDC 1818714: Experimental Crystal Structure Determination

2018

Related Article: Yuan Gao, Marta Viciano-Chumillas, Ana Maria Toader, Simon J. Teat, Marilena Ferbinteanu, Stefania Tanase|2018|Inorg.Chem.Front.|5|1967|doi:10.1039/C8QI00357B

Space GroupCrystallographyCrystal SystemCrystal StructureCell Parameterscatena-[oxonium pentakis(mu-cyano)-bis(mu-pyrazine-23-dicarboxylato)-heptaaqua-tris(cyano)-(methanol)-di-neodymium-potassium-tungsten tetrahydrate]Experimental 3D Coordinates
researchProduct