showing 36 of ~574560 from 574555 documents

3-4 GADUS VECU BĒRNU PAŠVADĪTAS DARBĪBAS SEKMĒŠANA PIRMSSKOLAS IZGLĪTĪBAS IESTĀDĒ

2022

Kvalifikācijas darba autore: Guna Brača Kvalifikācijas darba tēma: 3-4 gadus vecu bērnu pašvadītas darbības sekmēšana pirmsskolas izglītības iestādē. Pētījuma objekts: pirmsskolas pedagoģiskais process. Pētījuma priekšmets: 3 – 4 gadus vecu bērnu pašvadīta darbība. Pētījuma mērķis: sekmēt 3 – 4 gadus vecu bērnu pašvadītu darbību pirmsskolas izglītības iestādē. Pētījuma uzdevumi: 1.Skaidrot pašvadītas darbības jēdziena būtību; 2.Raksturot pašvadītas darbības raksturojumu pedagoģiskajā procesā; 3.Sniegt 3 – 4 gadus vecu bērnu pašvadītas darbības raksturojumu; 4.Raksturot rotaļnodarbības; 5.Veikt 3 – 4 gadus vecu bērnu pašvadītas darbības izpēti; 6.Izstrādāt un aprobēt izmēģinājuma darbību 3 -…

PedagoģijaPašvadīta mācīšanāsatgriezeniskā saiterotaļnodarbībadarba vide

Mārketinga komunikācija SIA "Dezinfa"

2022

Bakalaura darba “Mārketinga komunikācija SIA “Dezinfa”” mērķis ir balstoties uz mārketinga komunikāciju teorētiskajiem aspektiem un veiktā pētījuma rezultātiem, izpētīt un ieteikt ierosinājumus, kā uzlabot SIA “Dezinfa” mārketinga komunikāciju, lai palielinātu pārdošanas apjomus Latvijā. Darba teorētiskā daļa ietver teoriju par komunikāciju un mārketingu, mārketinga komunikāciju, integrēto mārketinga komunikāciju, pārdošanas veicināšanu un mārketinga komunikāciju kā pārdošanas elementu. Darba empīriskajā daļā tiek izmantotas trīs pētniecības metodes: kontentanalīze, aptauja un intervija. Bakalaura darba gaitā tika secināts, ka uzņēmums SIA Dezinfa veiksmīgi izmanto tādus mārketinga instrume…

integrētā mārketinga komunikācijamārketinga komunikācijaSIA Dezinfakomunikācija un mārketingsKomunikācijas zinātnepārdošanas veicināšana

Augstskolu gada pārskatu diahroniskā analīze

2022

Komunikācija ir jebkuras organizācijas nozīmīga daļa, tai skaitā arī augstskolu. Valodas pielietojuma analīzes augstskolu diskursos līdz šim veiktas tikai mājaslapām un brošūrām; gadu pārskati nav pētīti. Bakalaura darba mērķis ir analizēt LU Attīstības stratēģijā (2015. – 2020.) norādīto septiņu vērtību atspoguļojumu 2018., 2019. un 2020. gada pārskatā. Darba teorētiskajā daļā tiek izmantota integrējošā literatūras pārskatu metode un empīriskajā daļā tiek apspriesta pētījumā veiktā satura analīze. Analīzes rezultāti norāda, ka visos trīs pārskatos cilvēku un sadarbības vērtības ir ar lielāko leksisko vienību skaitu, no kā tiek secināts, ka tās ir visvairāk uzsvērtās.

ValodniecībaHigher education institutionsCommunicationSemantic fieldsAnnual reportsLexical units

Notice "Castoriadis"

2022

International audience

[SHS.SCIPO] Humanities and Social Sciences/Political scienceComputingMilieux_MISCELLANEOUS[SHS.SCIPO]Humanities and Social Sciences/Political science

Self-Efficacy and Study Burnout Among IT Students : Challenges and Potentials

2022

There is a risk of student dropout in the field of engineering, particularly in the domain of information technology. To find novel pedagogical and technological solutions to prevent student attrition, we must better understand student experiences regarding their learning and studying processes. This study was conducted within the introduction of a new engineering degree program at the University of Jyväskylä and focused on first-year students. The research questions are: How do IT students experience study burnout at the beginning of their studies? What kind of self-efficacy beliefs do IT students have at the beginning of their studies? How are the self-efficacy beliefs of IT students asso…

learning experiencesmotivaatiominäpystyvyysburnoutopiskelijatoppimiskokemuksethyvinvointiengineering educationuupumuskorkeakouluopetus10 12 [CDIO standards]student attritionself-efficacytietotekniikka-ala

Application of Mathematical Modelling and Symmetry in Neuroscience

2022

The first article is "Spectral Clustering Reveals Different Profiles of Central Sensitization in Women with Carpal Tunnel Syndrome (CTS)" [1]. CTS is considered to be one of the most prevalent entrapment neuropathies of the upper extremities. The most common symptoms experienced by CTS patients are sensory disturbances, such as pain, numbness, tingling, and/or paresthesia in areas innervated by the median nerve. This physical condition relates to unemployment and creates substantial health care costs, as well as an economic burden to the concern families. It is estimated that CTS has a lifetime prevalence of 3.1% and an incidence rate of 1.73 per 1000 person-year in the general population; …

NeurologiaSalut

Kriminālsods -sabiedriskais darbs

2022

Bakalaura darba nosaukums “Kriminālsods “Sabiedriskais darbs”” sevī ietver jau jaunā soda veida nosaukumu, kurš pieņemts 2020.gada 17.decembrī un Krimināllikumā stāsies spēkā 2022.gada 1.janvārī, attiecīgi arī bakalaura darbā autore izmantos jauno soda veida nosaukumu. Autore uzskata, ka bakalaura darba temats ir aktuāls, jo tas kā “Sabiedriskais darbs” tiek definēts tikai ar 2022.gada 1.janvāri. Līdz ar to šie grozījumi ietekmē ne tikai paša soda veida nosaukumu, bet arī tā piemērošanu. Bakalaura darba mērķis ir izpētīt un analizēt kriminālsoda “sabiedriskais darbs” jēdzienu, piemērošanu, vēsturisko attīstību, kā arī īpatnības un problēmas kādas bijušas līdz šim un kā to ietekmēs un mainīs…

NepilngadīgaisSabiedriskais darbsSoda veidsProbācijas klientsPiespiedu darbsJuridiskā zinātne

La asistencia en las cofradías penitenciales de Sevilla (1538-1701)

2022

Granado Hermosín, David: La asistencia en las cofradías penitenciales de Sevilla (1538-1701). En: Estudis: Revista de historia moderna, 48 2028: 157-176

religiosidadpiedad popularbeneficenciacofradíasUNESCO::HISTORIAasistencia:HISTORIA [UNESCO]

Mount Etna volcanic emissions signature on the chemical composition of bulk atmospheric deposition in Sicily, Italy.

2022

Mt. Etna, on the eastern coast of Sicily (Italy), is one of the most active and most intensely monitored volcanoes on the Earth, widely recognized as a big source of volcanic gases, such as CO2, SO2, halogens, and many trace elements, including technological critical elements (TCEs), to the atmosphere on a regional and global scale. Mt. Etna emissions account for a significant percentage of the worldwide average volcanic budget and especially during eruptive periods, its products can be dispersed over great distances and they influence the chemical composition of the atmosphere of other continents too. The current knowledge about the geochemical cycle of TCEs is still scarce, nevertheless, …

atmospheric deposition major ions trace elements volcanic emissions Mt. EtnaSettore GEO/08 - Geochimica E Vulcanologia

Kriminālatbildība par darbībām ar datiem, kas dod iespēju nelikumīgi izmantot maksāšanas līdzekļus

2022

Tehnoloģijām attīstoties, attīstās arī tautsaimniecības nozare, tai skaitā finanšu-kredīta sfēra, tādējādi pieaug pret to vērsto noziedzīgo nodarījumu daudzējādība, īpaši saistībā ar elektroniskajiem maksāšanas līdzekļiem. Ar maģistra darbu autore vēlas pievērst uzmanību Krimināllikuma 193.1 pantā ietvertā regulējuma teorētiskajiem un praktiskajiem piemērošanas aspektiem, jo šobrīd reti kurš tiesību normu piemērotājs patiesi izprot šī Krimināllikuma panta piemērošanas kritērijus. Darba gaitā autore iepazīsies ar doktrīnu un normatīvajiem aktiem, kuros skaidroti šī problēmjautājuma atslēgas jēdzieni, veiks Krimināllikuma 193.1 panta juridisko analīzi, iepazīsies un analizēs tiesu praksi. Dar…

nelikumīgas darbībasmaksāšanas līdzekliskvalifikācijadatiJuridiskā zinātne

La innovació territorial en el sector logístic valencià

2022

Els estudis d’anàlisi relacionats amb el desenvolupament territorial requereixen del coneixement d’aquells processos que generen creixement econòmic, faciliten l’activitat empresarial i creen ocupació; entre els quals, la innovació. En aquesta publicació, amb la finalitat de contribuir al coneixement del sector logístic, un àmbit complex i al mateix temps vital per a l’economia valenciana i el seu mercat laboral, se’n fa una caracterització, atenent a les infraestructures de comunicació, les principals àrees logístiques i les empreses del sector en el territori valencià. A la província de Castelló, a més de la citricultura i la indústria ceràmica, s’analitzen també les empreses de gestió lo…

UNESCO::GEOGRAFÍA::Geografía económica::Geografía de las actividadesestudisinnovaciólogística

Troubles du goût et de l'odorat chez les seniors

2022

chemosensory perceptionolder adult[SDV] Life Sciences [q-bio][SDV.AEN] Life Sciences [q-bio]/Food and Nutritionage[SDV.MHEP.GEG] Life Sciences [q-bio]/Human health and pathology/Geriatry and gerontologyageingagingaged adultgustationolfaction

Rilevanza delle definizioni normative ed overview procedimentale

2022

Il contributo analizza le principali definizioni normative contenute nel d.lgs. n. 49/2020, di attuazione della Direttiva UE 2017/1852, in tema di risoluzione delle controversie fiscali transfrontaliere in ambito eurounitario, ed opera altresì una panoramica sintetica delle due fasi di attuazione della procedura

Settore IUS/12 - Diritto TributarioTax Dispute Settlement Mutual Agreement Procedure questione controversa

Nesteroīdo pretiekaisuma līdzekļu lietošanas paradumi sabiedrībā

2022

Bakalaura darba tēma ir “Nesteroīdo pretiekaisuma līdzekļu lietošanas paradumi sabiedrībā’’. Aktualitāti nosaka tas, ka nesteroīdie pretiekaisuma līdzekļi ir vieni no vispieprasītākajiem medikamentiem. Bieži vien to lietošana notiek bez ārsta konsultācijas, jo medikamenti ir viegli pieejami pārdošanā. Neracionāla medikamentu lietošana var nodarīt neatgriezenisku kaitējumu veselībai. Pētniecības darba mērķis ir noskaidrot nesteroīdo pretiekaisuma līdzekļu lietošanas paradumus sabiedrībā. Izvirzītā hipotēze - sabiedrība pakļauta neracionālai nesteroīdo pretiekaisuma līdzekļu lietošanai, sakarā ar zināšanu trūkumu. Bakalaura darbs sastāv no 4 nodaļām un 8 apakšnodaļām. Darba teorētiskās daļas …

NESTEROĪDIE PRETIEKASUMA LĪDZEKLIPĒTĪJUMSMĀSZINĪBASSĀPESMedicīna

Tērpu noliktavas uzskaites sistēma

2022

Kvalifikācijas darbs “Tērpu noliktavas uzskaites sistēma” apraksta apģērbu noliktavas organizācijas aizmugursistēmas REST API servisa izstrādes procesu. Serviss paredzēts tādām organizācijām, kā teātri, operas, amatiermākslas kolektīvi u.c., kas nodarbojas tērpu, apģērbu uzglabāšanu, izsniegšanu un saņemšanu. Serviss sniedz iespēju organizācijām veikt efektīvu apģērbu uzskaiti, organizāciju un inventarizāciju. Pakalpojuma izstrādē izmantota programmēšanas valoda PHP 7.4 un ietvars Lumen 8. Dati tiek glabāti MySQL datu bāzē.

DatorzinātneRESTAPIHTTPLumenPHP

The Hierarchical Discrete Learning Automaton Suitable for Environments with Many Actions and High Accuracy Requirements

2022

Author's accepted manuscript Since its early beginning, the paradigm of Learning Automata (LA), has attracted much interest. Over the last decades, new concepts and various improvements have been introduced to increase the LA’s speed and accuracy, including employing probability updating functions, discretizing the probability space, and implementing the “Pursuit” concept. The concept of incorporating “structure” into the ordering of the LA’s actions is one of the latest advancements to the field, leading to the ϵ-optimal Hierarchical Continuous Pursuit LA (HCPA) that has superior performance to other LA variants when the number of actions is large. Although the previously proposed HCPA is …

VDP::Teknologi: 500::Informasjons- og kommunikasjonsteknologi: 550

Acetic acid leaching of neodymium magnets and iron separation by simple oxidative precipitation

2022

Neodymium-iron-boron (NdFeB) has become the most prominent permanent magnet alloy, with a wide variety of applications and an ever-increasing demand. Their recycling is important for securing the supply of critical raw materials used in their manufacturing. The use of organic acids such as acetic acid has been of recent interest for the recycling of waste NdFeB magnets. Despite achieving good leaching efficiencies, the published literature has not properly investigated the effects of key factors influencing the acetic acid leaching process and their respective interactions, which has lead to conflicting findings as to what conditions are optimal. The present work goes to show that no such o…

spent NdFeB magnetetikkahappocritical raw materialmetallituudelleenkäyttöharvinaiset maametallitiron precipitationREE [rare earth element]acetic acid leachingkierrätys

Šķēršļu pārvarēšanas kustību pilnveides iespējas 3-4 gadus veciem bērniem pastaigas laikā

2022

Kvalifikācijas darba tēma: ,, Šķēršļu pārvarēšanas kustību pilnveides iespējas 3-4 gadus veciem bērniem pastaigas laikā” Kvalifikācijas darba autore: Aiga Liepiņa Darba zinātniskais vadītājs: Mg. izgl. zin. Agita Klempere - Sipjagina Kvalifikācijas darba mērķis: teorētiski izzināt un praktiski pētīt šķēršļu pārvarēšanas kustību pilnveides iespējas 3-4 gadus veciem bērniem pastaigas laikā. Darbs sastāv: no teorētiskās un empīriskās daļas. Darba teorētiskajā daļā tiek izmantotas: D, Dzintares, I. Bulas-Bitenieces, L. Kalniņas, R. Jansones, T. Tripānes, I. Stangaines un citu pedagogu un psihologu atziņas par kustību ietekmi uz bērnu fizisko attīstību. Tiek aplūkoti tādi aspekti kā kustību akti…

apkārtējā videŠķēršļu pārvarēšanasPedagoģijakustības pilnveidepastaigas

Hva lærte lærerne under pandemien? Læreres erfaringer fra videregående skole under koronapandemien.

2022

Fra midten av mars 2020 ble tusenvis av elever og lærere plassert på hjemmeskole som resultat av Covid-19 pandemien. I løpet av uker med digital undervisning ble lærerne satt inn i ett stort forsøk med digital undervisning. Dette forsøket ble videreført ettersom pandemien utviklet seg og skolene vekslet mellom ulike smittenivåer med grønn, gul og rød sone i tiden som fulgte. Denne undersøkelsen tar for seg lærernes erfaringer fra hjemmeskolen. Hva har lærerne lært? Hvilke erfaringer har de gjort som de ønsker å videreføre når skolen er tilbake i normal drift, post pandemi? Studiet tar utgangspunkt i intervjuer av lærere ved en videregående skole som alle underviste ved studieforberedende ut…

Who are the Showroomers? Socio-Demographic Factors Behind the Showrooming Behavior on Mobile Devices

2022

This quantitative study focuses on socio-demographic variables and their associations with different forms of showrooming behavior. The purpose of this study is to find which consumer groups based on age, gender, and income level are demographically the most probable showroomers, and how much each of these variables explain showrooming. The data used is a structured online survey from 1,028 Finnish omnichannel consumers aged between 18 and 75 years. We compare the means of demographic groups’ shares on different aspects of showrooming, and then use partial least squares structural equation modeling with confirmatory factor analysis to see how much each of the variables explain showrooming. …

kivijalkaliikkeetshowroomingsosiodemografiset tekijätsocio-demographicsverkkokauppamyymälätconsumer behaviormobiilikauppakuluttajakäyttäytyminenostaminenomnichanneltuotetiedothinnatmonikanavaisuusmobile shopping

"Jeg har gått på skole i elleve år nå, og det har alltid vært det samme": En kvalitativ flerkasusstudie om elever sine refleksjoner knyttet til opple…

2022

Hovedtemaet i denne masteroppgaven er bruk av comparative judgement (CJ) i matematikkundervisning. Comparative judgement baserer seg på at det kan være lettere å sammenligne to og to objekter og vurdere dem ut fra et eller flere kriterier, enn å bare se på ett objekt. For eksempel kan det være vanskelig å vurdere vekten til en stein hvis du holder den, men hvis du holder to steiner så er det rimelig enkelt å vurdere hvilken av dem som er tyngst (Jones & Sirl, 2017). Mye av tidligere forskning rundt temaet har sett på bruk av CJ som et vurderingsverktøy, hvor forskningen viser at CJ har god reliabilitet. Vi ønsket i denne masteroppgaven å undersøke om et opplegg med CJ kan være et nyttig til…

Korejiešu bēru tradīcijas no 19. līdz 21. gadsimtam

2022

Šī bakalaura darba nosaukums ir “Korejiešu bēru tradīcijas no 19. līdz 21. gadsimtam”. Tajā ir apskatītas korejiešu bēru tradīcijas pēdējo 3 gadsimtu laikā, to izmaiņas un katra gadsimta tradīciju lielākie izmaiņu faktori. Nāve un sēras ir neizbēgama cilvēka dzīves daļa, ar ko jebkurš saskarsies kaut vienreiz mūžā, neatkarīgi no tautības, sabiedrības slāņa un reliģiskās piederības. Katrai tautai ir sava bēru kultūra un to papildinošo tradīciju kopums, taču nevienam nav izdevies tik veiksmīgi adaptēties līdzi laika plūdumam kā korejiešiem, sintezējot tradicionālo bēru ceremoniju ar mūsdienīgajām paražām vairāk nekā 300 gadu laikā. Līdz šim lielākā daļa pētījumu par šo tēmu ir bijuši tikai sa…

Āzijas studijasDienvidkorejaBēres19.gs.Bēru kultūra20.gs.

Genistein effect on cognition in prodromal Alzheimer's disease patients : the GENIAL clinical trial

2022

Background: Delaying the transition from minimal cognitive impairment to Alzheimer’s dementia is a major concern in Alzheimer’s disease (AD) therapeutics. Pathological signs of AD occur years before the onset of clinical dementia. Thus, long-term therapeutic approaches, with safe, minimally invasive, and yet efective substances are recommended. There is a need to develop new drugs to delay Alzheimer’s dementia. We have taken a nutritional supplement approach with genistein, a chemically defned polyphenol that acts by multimodal specifc mechanisms. Our group previously showed that genistein supplementation is efective to treat the double transgenic (APP/PS1) AD animal model. Methods: In this…

Amyloid beta-PeptidesSoy isofavonesCognitive NeurosciencePhytoestrogensNeuronesGenisteinCognitive impairmentAmyloid-beta cingulate gyrusCognitionNeurologyAlzheimer DiseaseMalaltiesHumansCognitive DysfunctionNeurology (clinical)

Uzņēmumu “Circle K Latvia” un “Virši-A” tēls sociālajos medijos Latvijā: popularitāte, atgriezeniskā saite un reakcijas

2022

Bakalaura darba tēma ir “Uzņēmumu “Circle K Latvia” un “Virši-A” tēls sociālajos medijos Latvijā: popularitāte, atgriezeniskā saite un reakcijas”. Darba mērķis ir noskaidrot un izpētīt, kādi ir “Circle K Latvia” un “Virši-A” tēli un popularitāte sociālajos medijos Latvijā – veicot salīdzinājumu saprast, kāda ir atgriezeniskā saite no sekotāju puses. Bakalaura darba teorētiskajā daļā autore ir izveidojusi trīs lielās nodaļas: mārketings, komunikācija un sociālie tīkli, savukārt, metodoloģiskajā daļā autore ir izmantojusi divas kvantitatīvās pētniecības metodes: aptauja tiešsaistē, ar kuras palīdzību tika uzzināts respondentu viedoklis par uzņēmumu komunikāciju un veiksmīgu zīmola tēlu; ar ot…

komunikācijamārketingssociālie tīkliKomunikācijas zinātneCircle K Latviazīmols

Gendered “family care work” and employment during the COVID-19 pandemic through the lens of educational attainment

2022

Employementpandemic[SHS.EDU] Humanities and Social Sciences/EducationGenderCovid-19Educational Attainment

Self-gravitating disks around rapidly spinning, tilted black holes: General relativistic simulations

2022

We perform general relativistic simulations of self-gravitating black hole-disks in which the spin of the black hole is significantly tilted ($45^\circ$ and $90^\circ$) with respect to the angular momentum of the disk and the disk-to-black hole mass ratio is $16\%-28\%$. The black holes are rapidly spinning with dimensionless spins up to $\sim 0.97$. These are the first self-consistent hydrodynamic simulations of such systems, which can be prime sources for multimessenger astronomy. In particular tilted black hole-disk systems lead to: i) black hole precession; ii) disk precession and warping around the black hole; iii) earlier saturation of the Papaloizou-Pringle instability compared to al…

AstrofísicaHigh Energy Astrophysical Phenomena (astro-ph.HE)AstronomiaFOS: Physical sciencesGeneral Relativity and Quantum Cosmology (gr-qc)Astrophysics - High Energy Astrophysical PhenomenaGeneral Relativity and Quantum Cosmology

Chapter VI. Illegal and Immoral Contracts. Usury. Good Faith in Contract Law. 4. Poland

2022

The sense of a patient: An ethnographic multi-site field study exploring the influence of manikins on nursing students' learning

2022

The purpose of this ethnographic study was to gain insight into the influence of full-body human-like manikins on nursing students’ learning. The research question that guided the study was: How do the presence and use of human-like manikins influence nursing students’ learning? Data were collected during 15 educational sessions, using different manikins for various activities. Applying cultural-historical activity theory, this study explored the use of manikins as a mediated activity. The study’s main result was the interplay of five categories. In the first category, manikin as an object, manikins were used to teach and learn technical skills. In the second category, manikin as a subject,…

Simulation-based learningCultural-historical activity theoryEthnographyTheory and practice of educationNursing educationNursing studentsQualitative studyVDP::Samfunnsvitenskap: 200::Pedagogiske fag: 280LB5-3640EducationInternational Journal of Educational Research Open

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B

Urodinamisko rādītāju analīze sievietēm ar urīna nesaturēšanu un to nozīme slimības diagnostikā un ārstēšanā

2022

Elektroniskā versija nesatur pielikumus

Medicīna un farmācijaVeselības aprūpeMedicīna

How sustainability factors influence maintenance of water distribution systems feeding manufacturing industries

2022

This work aims to analyse the role played by relevant sustainability factors towards the implementation of maintenance interventions in the manufacturing industrial sector. In this context, we focus on industrial water distribution systems, on whose effective work depends the functioning of core plants as well as general industrial facilities. In detail, we propose aMulti-Criteria Decision-Making (MCDM) application based on the use of the Analytic Network Process (ANP) as amethodological way to prioritise maintenance interventions while considering the influence of some of themost relevant sustainability factors identified in literature. The main advantage of such an approach consists in th…

Sustainability FactorIdustrial SystemsMulit-Criteria Decision-MakingMaintenanceManagementANP

5-6 gadus vecu bērnu ar autiska spektra traucējumiem emocionālās attīstības veicināšana muzikālās rotaļnodarbībās pirmsskolas izglītības iestādē

2022

Diplomdarba temats: 5-6 gadus vecu bērnu ar autiska spektra traucējumiem emocionālās attīstības veicināšana muzikālās rotaļnodarbībās pirmsskolas izglītības iestādē. Diplomdarba autore: Ieva Ozola Zinātniskā vadītāja: Dr. paed. Anna Līduma Kvalifikācijas darba apjoms: 43 lpp., 3 tabulas, 18 attēli, 8 pielikumi, izmantoti 43 literatūras avoti. Pētījuma mērķis: pētīt emocionālās attīstības veicināšanas iespējas muzikālās rotaļnodarbībās pirmsskolas izglītības iestādē bērniem ar autiskā spektra traucējumiem. Pētījuma jautājums: ar kādu muzikālo rotaļnodarbību saturu iespējams veicināt 5-6 gadus vecu bērnu ar autiska spektra traucējumiem emocionālo attīstību? Darbs sastāv no divām nodaļām. 1. n…

Muzikālās rotaļnodarbībasPedagoģijaAutiska spektra traucējumiPirmsskolas izglītības iestādeEmocionālā attīstība

Influence of axial mirror ratios on the kinetic instability threshold in electron cyclotron resonance ion source plasma

2022

International audience; Electron Cyclotron Resonance (ECR) ion source plasmas are prone to kinetic instabilities. The onset of the instabilities manifests as emission of microwaves, bursts of electrons expelled from the plasma volume, and the collapse of the extracted highly charged ion (HCI) currents. Consequently, the instabilities limit the HCI performance of ECR ion sources by limiting the parameter space available for ion source optimization. Previous studies have shown that the transition from stable to unstable plasma regime is strongly influenced by the magnetic field structure, especially the minimum field value inside the magnetic trap (Bmin). This work focuses to study the role o…

magnetic mirrorsplasma confinementsyklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]plasma heatingplasma instabilitieshiukkaskiihdyttimetelectron energy distribution functionsplasmafysiikkaCondensed Matter Physicsion sourcesPhysics::Plasma Physicscyclotron resonanceions and propertiesplasma (kaasut)

Condition and Role of the Norman Cathedrals in the Fourteenth Century: Maintenance, Restoration and Renovation

2022

After conquering Sicily between 1061 and 1091, the Normans built new cathedrals that modified not only religious life, but also architecture and urban layout. Dramatic events, like wars, earthquakes, and fires, clumsy restorations and culpable inaccuracy have profoundly altered the appearance of Norman cathedrals. The aim of this paper is to analyse the state of conservation of the Cathedrals of Palermo, Monreale, Messina and Agrigento in the fourteenth century, when Sicily was profoundly affected by the war between the Angevins and the Aragonese that lasted ninety years and impoverished the island. The analysis of four case studies from the past will allow us to outline new perspectives fo…

Cathedrals Middle Ages Sicily RestorationSettore M-STO/01 - Storia Medievale

Investigating charm production and fragmentation via azimuthal correlations of prompt D mesons with charged particles in pp collisions at √s = 13 TeV

2022

Angular correlations of heavy-flavour and charged particles in high-energy proton–proton collisions are sensitive to the production mechanisms of heavy quarks and to their fragmentation as well as hadronisation processes. The measurement of the azimuthal-correlation function of prompt D mesons with charged particles in proton–proton collisions at a centre-of-mass energy of √s=13 TeV with the ALICE detector is reported, considering D0, D+, and D∗+ mesons in the transverse-momentum interval 30.3 GeV/c and pseudorapidity |η|<0.8. This measurement has an improved precision and provides an extended transverse-momentum coverage compared to previous ALICE measurements at lower energies. The study …

High Energy Physics::ExperimenthiukkasfysiikkaNuclear Experiment

Striking a balance between disinformation on social media platforms and freedom of expression in the European Union

2022

The growing influence and adverse effects of disinformation on social media platforms have already presented challenges not only to the European Union and its Member States but also to social media platforms and human rights activists. One of the most crucial challenges from a legal perspective has been finding the appropriate tools to regulate disinformation while preserving the right to freedom of speech, bearing in mind that there is no uniform definition of disinformation on a global level. While there are notable attempts to limit the spread of disinformation on social media platforms from the European Commission and the various Member States, this thesis aims to analyse their effectiv…

Freedom of expressionDisinformation:LAW/JURISPRUDENCE::Other law::European law [Research Subject Categories]European Convention on Human Rights