Search results for " Infrastructure"

showing 10 items of 269 documents

Manufacturing export performance and public capital: an analysis by country technology position

2021

The objective of this paper is to examine the relationship between public capital and manufacturing export performance. It also aims at investigating whether this relationship depends on the proximity of a country's technology frontier. To achieve this, we adopted a methodology that estimates the elasticities of public capital as a non-rival factor in a model that considers factor intensity as a mechanism of industrial development. We use an interaction model with panel data from 1999 to 2014 across 35 advanced and less advanced countries. Our results show that in countries far from the technology frontier, public capital accumulation is an element of industrial development as opposed to co…

proximity to the technological frontierPublic infrastructureJEL: F - International Economics/F.F1 - Trade/F.F1.F11 - Neoclassical Models of TradeComparative advantageJEL: H - Public Economics/H.H4 - Publicly Provided Goods/H.H4.H41 - Public GoodsJEL: O - Economic Development Innovation Technological Change and Growth/O.O4 - Economic Growth and Aggregate Productivity/O.O4.O47 - Empirical Studies of Economic Growth • Aggregate Productivity • Cross-Country Output Convergence[SHS.ECO] Humanities and Social Sciences/Economics and Finance[SHS.ECO]Humanities and Social Sciences/Economics and FinanceManufacturing exports
researchProduct

Cost that is Directly Incurred as a Result of Operating the Train Service on the 1520 mm Rail with Primarily Freight Transportation

2016

AbstractUnder the Directive 2012/34/EU (21 November 2012) “the charges for … [rail] infrastructure … shall be set at the cost that is directly incurred as a result of operating the train service”. This charging rule is new for Baltic States’ railways, where due to the favorable geographic position a full cost application without detalization was possible. Although, a big number of relevant studies on the issue was made in EU, all of them covered only 1435mm railways with primarily passenger transportation. This study has been made in order to understand the impact of train operating on 1520mm rail infrastructure with primarily freight transportation.A gradual model of infrastructure chargin…

railway costs; charging model; 1520mm railway050210 logistics & transportationEngineeringbusiness.industrymedia_common.quotation_subject05 social sciencesProcess (computing)02 engineering and technologycharging modelDirectiveTransport engineering020303 mechanical engineering & transports0203 mechanical engineeringOrder (exchange)Service (economics)0502 economics and businessFull costPosition (finance)1520 mm railwaybusinessrailway costsRail infrastructuremedia_commonTransportation Research Procedia
researchProduct

The proposal to transform an old limestone quarry into a botanical garden with a rainforest zone: a case study

2019

Nowadays, a significant part of cities is tackling the problems with post-mining areas. This manuscript is an original research which shows possibilities of their reclamation. The aim of the article is to present the proposal of developing the closed limestone quarry and creating a botanical garden. The proposed spatial solutions allow for creating a new, tourist and recreation space, maintaining the natural heritage. The work also assumed carrying out a dendrological inventory, in order to determine the existing dendrofl ora. The required spatial, nature and communication analyses, which illustrate the current condition of the area and defi ne further design works, have also been carried o…

reclamationAgroforestrysustainability planningecological restorationBiodiversityBuilding and ConstructionRainforestGeotechnical Engineering and Engineering GeologyEngineering (General). Civil engineering (General)Environmental technology. Sanitary engineeringBiodiversity conservationGeographygreen infrastructureLand reclamationBotanical gardenbiodiversity conservationTA1-2040Green infrastructureRestoration ecologyTD1-1066Earth-Surface ProcessesGeneral Environmental ScienceCivil and Structural EngineeringbiodiversityPrzegląd Naukowy Inżynieria i Kształtowanie Środowiska
researchProduct

Re-Urban | De-frag. Progetti per trasformare la circonvallazione di Palermo

2014

This article presents a short survey of contemporary approaches to re-cycling, up-cycling and recovering urban freeways. Further, it introduces the assumptions and some initial descriptions of cases study of the Degree studio "In-FRA. Architettura e infrastruttura nella città contemporanea", that Z. Tesoriere conducts since 2013 at the University of Palermo. The studio focuses on how enhancing architectural conditions of urban freeways in contemporary urban realm, with particular attention to the circonvallazione of Palermo.

recycling urban freeways architectural infrastructureSettore ICAR/14 - Composizione Architettonica E Urbana
researchProduct

Infrastructural and Human Factors Affecting Safety Outcomes of Cyclists

2018

The increasing number of registered road crashes involving cyclists during the last decade, and the high proportion of road crashes resulting in severe injuries and fatalities among cyclists constitutes a global issue for community health, urban development, and sustainability. Nowadays, the incidence of many risk factors for road crashes of cyclists remains largely unexplained. Given the importance of this issue, the present study has been conducted with the aim of determining relationships between infrastructural, human factors and safety outcomes of cyclists. Objectives: This study aimed, first, to examine the relationship between key infrastructural and human factors present in cycling,…

self-reported road crashesGeography Planning and Developmentbicycle usersTJ807-830Management Monitoring Policy and LawinfrastructureLogistic regressionDemographic dataTD194-195Renewable energy sourcesrisky behavioursGlobal issueUrban planningEnvironmental health0502 economics and business0501 psychology and cognitive sciencesGE1-350050107 human factors050210 logistics & transportationEnvironmental effects of industries and plantsRenewable Energy Sustainability and the EnvironmentSeguretat viària05 social sciencesapplied_psychologyEnvironmental sciencesGeographyPsicologiacyclists; bicycle users; risky behaviours; human factors; infrastructure; self-reported road crashes; road safetyCommunity healthSustainabilitycyclistsroad safetyPsychologyhuman activitieshuman factorsSustainability; Volume 10; Issue 2; Pages: 299
researchProduct

Software architectures for mobile computing

1999

software architecturenetworking infrastructurehybrid communicatorglobal connectivitymobile computingubiquitous computingminiaturisationbluetoothWAP architecture
researchProduct

Data storage infrastructure laboratory

2021

El material ha obtingut un premi Fernando Sapiña del SPL. El material correspon a la part experimental de l'assignatura Infraestructura d'Emmagatzematge de Dades, de segon curs del Grau en Ciència de Dades de la Universitat de València. El material està dividit en una introducció, una pràctica 0 a realitzar a casa, i 7 sessions a realitzar en el laboratori de l'assignatura. Les pràctiques es realitzen amb una màquina virtual Linux, que es pot descarregar pels i les estudiants. A la sessió 0 es realitza la instal·lació de la màquina virtual i s'introdueixen les primeres instruccions del intèrpret d’ordres . En la sessió 1 s'aprofundeix en l’intèrpret d’ordres, passant-se en la sessió 2 a org…

storage infrastructuresystem administrationUNESCO::MATEMÁTICAS::Ciencia de los ordenadores::Informáticadata science
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Health care and cyber threats

2019

ta113critical infrastructurecyber threatkyberuhkaterveydenhuoltocyber securitykyberturvallisuushealth carekriittinen infrastruktuuriFinnish Journal of eHealth and eWelfare
researchProduct

Towards the cyber security paradigm of ehealth: Resilience and design aspects

2017

Digital technologies have significantly changed the role of healthcare clients in seeking and receiving medical help, as well as brought up more cooperative policy issues in healthcare cross-border services. Citizens continue to take a more co-creative role in decisions about their own healthcare, and new technologies can enable and facilitate this emergent trend. In this study, healthcare services have been intended as a critical societal sector and therefore healthcare systems are focused on as critical infrastructures that ought to be protected from all types of fears, including cyber security threats and attacks. Despite continual progress in the systemic risk management of cyber domain…

ta113e-healthcareEmerging technologiesbusiness.industrycyber securityComputer securitycomputer.software_genreAnticipation (artificial intelligence)Critical information infrastructureHealth careSystemic riskeHealthBusinessteleterveydenhuoltoResilience (network)kyberturvallisuuscomputerHealthcare system
researchProduct