Search results for " PL"

showing 10 items of 24591 documents

Effects of magnetic configuration on hot electrons in a minimum-B ECR plasma

2020

International audience; To investigate the hot electron population and the appearance of kinetic instabilities in highly charged electron cyclotron resonance ion source (ECRIS), the axially emitted bremsstrahlung spectra and microwave bursts emitted from ECRIS plasma were synchronously measured on SECRAL-II (Superconducting ECR ion source with Advanced design in Lanzhou No. II) ion source with various magnetic field configurations. The experimental results show that when the ratio of the minimum field to the resonance field (i.e. Bmin/Becr ) is less than ~0.8, the bremsstrahlung spectral temperature Ts increases linearly with the Bmin/Becr –ratio when the injection, extraction and radial mi…

010302 applied physicsPhysics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceBremsstrahlungResonancePlasmaCondensed Matter Physics01 natural sciencesElectromagnetic radiationElectron cyclotron resonance010305 fluids & plasmasMagnetic fieldNuclear Energy and Engineering0103 physical sciencesAtomic physicsMicrowave
researchProduct

Hydrogen plasma induced photoelectron emission from low work function cesium covered metal surfaces

2017

Experimental results of hydrogen plasma induced photoelectron emission from cesium covered metal surfaces under ion source relevant conditions are reported. The transient photoelectron current during the Cs deposition process is measured from Mo, Al, Cu, Ta, Y, Ni, and stainless steel (SAE 304) surfaces. The photoelectron emission is 2–3.5 times higher at optimal Cs layer thickness in comparison to the clean substrate material. Emission from the thick layer of Cs is found to be 60%–80% lower than the emission from clean substrates. peerReviewed

010302 applied physicsPhysicsta114HydrogenTantalumAnalytical chemistrytransitionchemistry.chemical_elementSubstrate (electronics)plasmasCondensed Matter Physics01 natural sciencesIon sourcework functions010305 fluids & plasmasion sourceschemistryAluminiumCaesium0103 physical sciencesWork functionLayer (electronics)photoemissionPhysics of Plasmas
researchProduct

Cyclotron instability in the afterglow mode of minimum-B ECRIS.

2016

It was shown recently that cyclotron instability in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source (ECRIS) causes perturbation of the extracted ion current and generation of strong bursts of bremsstrahlung emission, which limit the performance of the ion source. The present work is devoted to the dynamic regimes of plasma instability in ECRIS operated in pulsed mode. Instability develops in decaying plasma shortly after heating microwaves are switched off and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high energy electrons. Time-resolved measurements of microwave emission bursts are presented. I…

010302 applied physicsPhysicsta114ta213Astrophysics::High Energy Astrophysical Phenomenaplasma instabilityCyclotronBremsstrahlungPlasma01 natural sciencesInstabilityIon sourceElectron cyclotron resonance010305 fluids & plasmaslaw.inventionTwo-stream instabilityPhysics::Plasma Physicslaw0103 physical scienceselectron cyclotron resonance ion sourcesAtomic physicsInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct

THE GYROTRON STARTUP SCENARIO IN THE SINGLE MODE TIME DEPENDENT APPROACH

2019

The paper explains how to solve the Gyrotron equation system in the Single Mode Time Dependent Approach. In particular, we point out problems encountered when solving these well-known equations. The starting current estimation approach a using time model is suggested. The solution has been implemented in the Matlab code, which is attached to the article.

010302 applied physicsPhysicstime dependent approachgyrotronNuclear engineeringSingle-mode optical fiberMatlab code01 natural sciences010305 fluids & plasmaslaw.inventiondifferential equationlawModeling and SimulationGyrotron0103 physical sciencesQA1-939MathematicsAnalysisMathematical Modelling and Analysis
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Interface evolution during magnetic pulse welding under extremely high strain rate collision: mechanisms, thermomechanical kinetics and consequences

2020

Abstract Magnetic pulse welding enables to produce perplexing interfacial morphologies due to the complex material response during the high strain rate collision. Thus, a thermomechanical model is used in this study to investigate the formation mechanism of the wake, vortex, swirling and mesoscale cavities with the increase of the impact intensity at the interface. The formation of these interfacial features are difficult to characterize by insitu methods, thus the origin of phenomena still remain a subject of open discussion. Our studies identify the governing mechanisms and the associated thermomechanical kinetics, which are responsible for the formation mechanism of interfacial features.…

010302 applied physicsShearing (physics)Materials sciencePolymers and PlasticsMetals and AlloysMesoscale meteorology02 engineering and technologyWeldingMechanicsWake021001 nanoscience & nanotechnology01 natural sciencesElectronic Optical and Magnetic Materialslaw.inventionVortexMagnetic pulse weldinglaw0103 physical sciencesCeramics and Composites0210 nano-technologyAdiabatic processEjectaActa Materialia
researchProduct

Synergistic effect of fiber content and length on mechanical and water absorption behaviors of Phoenix sp. fiber-reinforced epoxy composites

2016

Phoenix sp. fiber-reinforced epoxy composites have been manufactured using compression molding technique. The effect of reinforcement volume content (0%, 10%, 20%, 30%, 40%, and 50%) and size (300 µm particles, 10 mm, 20 mm, and 30 mm fibers) on quasi-static and dynamic mechanical properties was investigated. Moreover, the water absorption properties of composites were analyzed at different environmental conditions (10℃, 30℃, and 60℃). For each reinforcement size, composites loaded with 40% in volume show highest tensile and flexural properties. Furthermore, composites with 300 µm particles present the best impact properties and the lowest water absorption, regardless of the environmental …

010302 applied physicsVolume contentAbsorption of waterMaterials sciencePolymers and PlasticsMaterials Science (miscellaneous)dynamic mechanical propertieCompression molding02 engineering and technologyEpoxy021001 nanoscience & nanotechnology01 natural sciencesIndustrial and Manufacturing Engineeringwater absorptionvolume fractionvisual_art0103 physical sciencesVolume fractionvisual_art.visual_art_mediummechanical propertieChemical Engineering (miscellaneous)FiberComposite materialPhoenix sp. fiber0210 nano-technologyJournal of Industrial Textiles
researchProduct

An Experimental Study of Waveguide Coupled Microwave Heating with Conventional Multicusp Negative Ion Source

2015

Negative ion production with conventional multicusp plasma chambers utilizing 2.45 GHz microwave heating is demonstrated. The experimental results were obtained with the multicusp plasma chambers and extraction systems of the RFdriven RADIS ion source and the filament driven arc discharge ion source LIISA. A waveguide microwave coupling system, which is almost similar to the one used with the SILHI ion source, was used. The results demonstrate that at least one third of negative ion beam obtained with inductive RF-coupling (RADIS) or arc discharge (LIISA) can be achieved with 1 kW of 2.45 GHz microwave power in CW mode without any modification of the plasma chamber. The co-extracted electro…

010302 applied physicsWaveguide (electromagnetism)Materials scienceFOS: Physical sciencesPlasmaElectron7. Clean energy01 natural sciencesIon sourcePhysics - Plasma Physics010305 fluids & plasmasIonPlasma Physics (physics.plasm-ph)Electric arcPhysics::Plasma Physics0103 physical sciencesAtomic physicsMicrowaveBeam (structure)
researchProduct

Ultrasonic nebulization inductively coupled plasma optical emission spectrometry method for wine analysis

2020

Abstract A methodology was developed to determine mineral elements in wines using Inductively Coupled Plasma Optical Emission Spectrometry combined with ultrasonic nebulization. The concentration of 36 elements (Al, B, Ba, Bi, Ca, Cd, Ce, Co, Cr, Dy, Er, Eu, Fe, Gd, K, La, Lu, Mg, Mn, Mo, Na, Nd, Ni, Pb, Pr, Sb, Sc, Sm, Sr, Tb, Ti, Tm, V, Y, Yb, and Zn) was determined in 59 wine samples and used to distinguish between Brazilian and Spanish wines. The best conditions for the plasma were selected using a two-level factorial design: radiofrequency power 1500 W; plasma gas flow rate 15 L min−1; auxiliary 0.70 L min−1; and nebulizer 0.40 L min−1. An exploratory multivariate analysis by Principal…

010302 applied physicsWineRiver valleyChemistry010401 analytical chemistryAnalytical chemistryMineral composition01 natural sciencesAtomic and Molecular Physics and OpticsUltrasonic nebulization0104 chemical sciencesAnalytical ChemistryInductively coupled plasma atomic emission spectroscopy0103 physical sciencesInductively coupled plasmaOptical emission spectrometryInstrumentationSpectroscopySpectrochimica Acta Part B: Atomic Spectroscopy
researchProduct

Spark Plasma Sintering of Metallic Glasses

2019

Spark plasma sintering (SPS) of metallic glasses (MG) can be quite different from sintering crystalline metallic alloys. Indeed, MG behave differently with increasing temperature, as they encounter a glass transition and devitrification. Their shaping can thus be compared to what can be performed on thermoplastic polymers. SPS is a promising way to prepare bulk parts from amorphous powders, since it allows very fast heating and cooling rates. It gives an advantage to avoid or limit devitrification of the amorphous phase upon the thermal cycle. However, diffusion mechanisms, which generally control densification, are activated at temperatures that are not compatible with MG structural integr…

010302 applied physics[CHIM.MATE] Chemical Sciences/Material chemistryAmorphous metalMaterials scienceDiffusionComposite numberSinteringSpark plasma sintering02 engineering and technology[CHIM.MATE]Chemical Sciences/Material chemistry01 natural sciencesAmorphous solid020303 mechanical engineering & transportsDevitrification0203 mechanical engineering0103 physical sciencesComposite materialGlass transitionComputingMilieux_MISCELLANEOUS
researchProduct