Search results for " Ventricular dysfunction"

showing 10 items of 31 documents

Prognostic value of right ventricular dysfunction or elevated cardiac biomarkers in patients with low-risk pulmonary embolism: a systematic review an…

2018

Abstract Aims Patients with acute pulmonary embolism (PE) classified as low risk by the Pulmonary Embolism Severity Index (PESI), its simplified version (sPESI), or the Hestia criteria may be considered for early discharge. We investigated whether the presence of right ventricular (RV) dysfunction may aggravate the early prognosis of these patients. Methods and results We did a systematic review and meta-analysis of studies including low-risk patients with acute PE to investigate the prognostic value of RV dysfunction. Diagnosis of RV dysfunction was based on echocardiography or computed tomography pulmonary angiography. In addition, we investigated the prognostic value of elevated troponin…

MaleComputed Tomography AngiographyVentricular Dysfunction Right030204 cardiovascular system & hematologySeverity of Illness Index0302 clinical medicineNatriuretic peptidePulmonary angiographyHospital MortalityRight ventricular dysfunctionAged 80 and overbiologyMortality rateHome treatmentMiddle AgedPrognosisTroponinPulmonary embolismEchocardiographyMeta-analysisAcute DiseaseCardiologyFemaleCardiology and Cardiovascular MedicineAdultmedicine.medical_specialtymedicine.drug_classFast Track Clinical ResearchRisk Assessment03 medical and health sciencesAnticoagulationInternal medicinemedicineHumansMortalityNatriuretic PeptidesRisk stratificationAgedbusiness.industryPulmonary embolismAnticoagulants030229 sport sciencesOdds ratiomedicine.diseaseTroponinConfidence intervalEditor's Choicebiology.proteinbusinessBiomarkersEuropean Heart Journal
researchProduct

Zofenopril and ramipril in patients with left ventricular systolic dysfunction after acute myocardial infarction: A propensity analysis of the Surviv…

2016

Introduction: This was a propensity score analysis of the prospective, randomized, double-blind Survival of Myocardial Infarction Long-term Evaluation (SMILE) 4 study in which one-year treatment with zofenopril 60 mg plus acetylsalicylic acid (ASA) 100 mg gave superior results compared to ramipril 10 mg plus ASA in terms of death or hospitalization for cardiovascular causes in patients with acute myocardial infarction (AMI) complicated by left ventricular dysfunction (LVD). Materials and methods: A total of 716 patients of the intention-to-treat population were divided into homogeneous propensity quintiles (Q) using a logistic regression model (QI: best risk profile; QV: worst risk profile)…

MaleMedicine (General)Time FactorsCaptoprilIntention to Treat AnalysiLeftMyocardial Infarction030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineEndocrinologyRamiprilPropensity analysisAcetylsalicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Left ventricular dysfunction; Propensity analysis; Captopril; Demography; Drug Therapy Combination; Endpoint Determination; Female; Hospitalization; Humans; Intention to Treat Analysis; Male; Middle Aged; Myocardial Infarction; Ramipril; Survival Analysis; Time Factors; Ventricular Dysfunction Left; Propensity Score; Internal Medicine; EndocrinologyVentricular DysfunctionMedicine030212 general & internal medicineMyocardial infarctioneducation.field_of_studyLeft ventricular dysfunctionElectrocardiography in myocardial infarctionMiddle AgedZofenoprilIntention to Treat AnalysisHospitalizationCombinationCardiologyOriginal ArticleDrug Therapy CombinationFemaleSurvival AnalysiPropensity analysimedicine.drugHumanRamiprilmedicine.medical_specialtyTime FactorEndpoint DeterminationPopulationAcute myocardial infarction03 medical and health sciencesR5-920Drug TherapyInternal medicineAngiotensin-converting enzyme inhibitorsAcetylsalicylic acidInternal MedicineHumanseducationPropensity ScoreDemographybusiness.industryOdds ratiomedicine.diseaseSurvival AnalysisConfidence intervalchemistryAngiotensin-converting enzyme inhibitorPropensity score matchingbusiness
researchProduct

Early discharge and home treatment of patients with low-risk pulmonary embolism with the oral factor Xa inhibitor rivaroxaban: an international multi…

2020

Abstract Aims To investigate the efficacy and safety of early transition from hospital to ambulatory treatment in low-risk acute PE, using the oral factor Xa inhibitor rivaroxaban. Methods and results We conducted a prospective multicentre single-arm investigator initiated and academically sponsored management trial in patients with acute low-risk PE (EudraCT Identifier 2013-001657-28). Eligibility criteria included absence of (i) haemodynamic instability, (ii) right ventricular dysfunction or intracardiac thrombi, and (iii) serious comorbidities. Up to two nights of hospital stay were permitted. Rivaroxaban was given at the approved dose for PE for ≥3 months. The primary outcome was sympto…

Malehome treatmentpulmonary embolismrisk stratification030204 cardiovascular system & hematology0302 clinical medicineRivaroxabanRecurrenceRisk FactorsOutpatientsMedicineProspective StudiesRight ventricular dysfunctionEarly dischargeAged 80 and overeducation.field_of_studyHome treatmentriskinarviointiMiddle AgedEUROPEAN-SOCIETYPatient DischargeINPATIENT TREATMENT3. Good healthPulmonary embolismTreatment OutcomeHOSPITALIZATIONAmbulatoryright ventricular dysfunctionFemaleCardiology and Cardiovascular Medicinemedicine.drugAdultmedicine.medical_specialtyAdolescentmanagement trialpotilaan kotiuttaminenkotihoitoPopulationDrug Administration Schedule03 medical and health sciencesYoung AdultInternal medicineMANAGEMENTkliiniset kokeetHumansseurantaddc:610Home treatment; Management trial; Pulmonary embolism; Right ventricular dysfunction; Risk stratification; RivaroxabaneducationRisk stratificationAgedRivaroxabanbusiness.industryManagement trial030229 sport sciences3126 Surgery anesthesiology intensive care radiologymedicine.diseaseInterim analysisOUTPATIENT TREATMENTConfidence intervalhyytymisenestohoitoClinical trialTHROMBOSIS3121 General medicine internal medicine and other clinical medicinelääkehoitosydän- ja verisuonitauditveritulppabusinessPulmonary EmbolismFactor Xa InhibitorsEuropean heart journal
researchProduct

Ventricular dysfunction and number of non compacted segments in non compaction: Non-independent predictors.

2010

Abstract Background Isolated ventricular noncompaction (IVNC) is characterized by multiple prominent trabeculations and deep intertrabecular recesses. Some reports prove that the chronic heart failure may occur in approximately half of the patients. In this report we investigate the correlation between the number of non compacted segments and entity of systolic dysfunction from the registry and subregistries of the SIEC. Method To identify the correlation between ventricular dysfunction and number of segments involved in non compaction we evaluated a consecutive series of 238 patients affected by non compaction, from the SIEC (Societa Italiana di Ecografia Cardiovascolare) registry. The ave…

Malemedicine.medical_specialtyAdolescentCardiomyopathyVentricular non compactionDiastoleCardiomyopathyProminent trabeculationsSeverity of Illness IndexNOVentricular Dysfunction LeftYoung AdultPredictive Value of TestsInternal medicinemedicineHumansRegistriesChildVentricular dysfunctionAgedVentricular non compaction; Cardiomyopathy; Ventricular dysfunction; Number of segments; Compact/spongy ratioAged 80 and overIsolated Noncompaction of the Ventricular Myocardiumbusiness.industryCompact/spongy ratioInfantMiddle Agedmedicine.diseaseNumero signPredictive factorSurgeryHeart failureChild PreschoolCardiologyNumber of segmentsFemaleMyocardial diseaseCardiology and Cardiovascular MedicinebusinessCardiomyopathy; Number of segments Compact/spongy ratio; Ventricular dysfunction; Ventricular non compactionHeart Failure Systolic
researchProduct

Inflammation in right ventricular dysfunction due to thromboembolic pulmonary hypertension

2009

Activation of the immune system is well established in patients with chronic heart failure (CHF) and impaired left ventricular function. High levels of pro-inflammatory cytokines are associated with a poor prognosis. Chronic thromboembolic pulmonary hypertension (CTEPH) frequently leads to impaired right ventricular function. It is not known whether such patients display chronic immune activation as well.We studied 49 patients with CTEPH (50±2 years, right ventricular ejection fraction [RVEF] 29±2%, left ventricular ejection fraction [LVEF] 51±3%, mean±SEM) and compared their results with 17 patients with CHF (71±2 years, LVEF 23±1%) and 34 age-matched control subjects (age 57±2 years). We …

Malemedicine.medical_specialtymedicine.drug_classHypertension PulmonaryVentricular Dysfunction RightInflammationImmune systemInternal medicinemedicineNatriuretic peptideHumanscardiovascular diseasesReceptorInflammationEjection fractionbusiness.industryMiddle Agedmedicine.diseaseRight ventricular dysfunctionHeart failurecardiovascular systemCardiologyFemaleTumor necrosis factor alphamedicine.symptomPulmonary EmbolismCardiology and Cardiovascular MedicinebusinessInternational Journal of Cardiology
researchProduct

Cost-effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post hoc analysis of SMI…

2013

Claudio Borghi,1 Ettore Ambrosioni,1 Stefano Omboni,2 Arrigo FG Cicero,1 Stefano Bacchelli,1 Daniela Degli Esposti,1 Salvatore Novo,3 Dragos Vinereanu,4 Giuseppe Ambrosio,5 Giorgio Reggiardo,6 Dario Zava7 1Unit of Internal Medicine, Policlinico S Orsola, University of Bologna, Bologna, Italy; 2Italian Institute of Telemedicine, Varese, Italy; 3Division of Cardiology, University of Palermo, Palermo, Italy; 4University and Emergency Hospital, Bucharest, Romania; 5Division of Cardiology, University of Perugia, Perugia, Italy; 6Mediservice, Milano, Italy; 7Istituto Lusofarmaco d'Italia SpA, Peschiera Borromeo, Italy Background: In SMILE-4 (the Survival of Myocardial Infarction Long-term…

Ramiprilmedicine.medical_specialtyCost effectivenessEconomics Econometrics and Finance (miscellaneous)Populationacute myocardial infarctionramiprilchemistry.chemical_compoundInternal medicinePost-hoc analysismedicinezofenoprilMyocardial infarctioneducationcost-effectivenesshealth care economics and organizationsOriginal Researchleft ventricular dysfunctioneducation.field_of_studylcsh:R5-920business.industryHealth Policylcsh:RM1-950acetylsalicylic acidmedicine.diseaseSMILE studycost effectiveness analysis (CEA)Confidence intervalZofenoprilangiotensin-converting enzyme inhibitorsClinicoEconomics and Outcomes Researchlcsh:Therapeutics. PharmacologychemistryCardiologyNumber needed to treatMedical emergencybusinesslcsh:Medicine (General)medicine.drug
researchProduct

Randomised comparison of zofenopril and ramipril plus acetylsalicylic acid in postmyocardial infarction patients with left ventricular systolic dysfu…

2015

Objective Conflicting evidence exists on the benefits of treating patients with coronary artery disease and preserved left ventricular ejection fraction (LVEF) with an ACE inhibitor. This retrospective analysis of the SMILE-4 Study sought to compare the efficacy of zofenopril 60 mg plus acetylsalicylic acid (ASA) versus ramipril 10 mg plus ASA 100 mg in patients with acute myocardial infarction (AMI) and heart failure, according to an impaired or preserved LVEF. Methods The primary study end point was 1-year combined occurrence of death or hospitalisation for cardiovascular causes. A preserved LVEF was defined by a baseline LVEF >40% and an impaired one by an LVEF ≤40%. Results 448 patients…

Ramiprilmedicine.medical_specialtyacute myocardial infarctionInfarctionramiprilCoronary Artery DiseaseCoronary artery diseasechemistry.chemical_compoundInternal medicinemedicinezofenopril1506cardiovascular diseasesMyocardial infarctionleft ventricular dysfunctionEjection fractionbusiness.industryleft ventricular ejection fractionmedicine.diseaseZofenoprilangiotensin-converting enzyme inhibitorsangiotensin-converting enzyme inhibitorchemistryacute myocardial infarction; angiotensin-converting enzyme inhibitors; left ventricular dysfunction; left ventricular ejection fractionHeart failureACE inhibitorcardiovascular systemCardiologyCardiology and Cardiovascular Medicinebusinesscirculatory and respiratory physiologyBiomedical engineeringmedicine.drugOpen Heart
researchProduct

Takotsubo cardiomyopathy after a positive emotional stress

2013

Takotsubo cardiomyopathy, also known as transient left ventricular apical ballooning syndrome, is a cardiac syndrome mimicking an acute coronary syndrome and characterized by peculiar transient left ventricular wall motion in the absence of significant coronary lesions at coronary angiography. The pathogenic mechanisms linking emotional stress to Takotsubo cardiomyopathy still remain undefined. The onset of Takotsubo cardiomyopathy can be triggered by an acute, intense emotional stress. This is the first report reporting that not only negative stress but also positive stressful event may precede the syndrome.

Takotsubo cardiomyopathy emotional stress left ventricular dysfunction coronary syndrome.
researchProduct

Hyperuricemia in patients with left ventricular dysfunction

2013

Introduction: Hyperuricemia is a cardiovascular risk factor associated with oxidative stress and inflammation, conditions that are involved in the genesis of atherosclerotic disease and in the progression of ischemic heart disease to heart failure. The aim of our retrospective study is to evaluate the variations of serum uric acid level in patients with ventricular dysfunction, in order to highlight any correlations. Methods: We enrolled 118 patients. In our population we identified three groups: patients with systolic and diastolic dysfunction (ejection fraction <50% and E wave 50% and E wave50% and E wave> A wave, n = 54). All patients underwent echocardiography and laboratory test …

Uric acid left ventricular dysfunction diastolic dysfunction
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct