Search results for " effective"

showing 10 items of 380 documents

Dose calculation in biological samples in a mixed neutron-gamma field at the TRIGA reactor of the University of Mainz

2010

To establish Boron Neutron Capture Therapy (BNCT) for non-resectable liver metastases and for in vitro experiments at the TRIGA Mark II reactor at the University of Mainz, Germany, it is necessary to have a reliable dose monitoring system. The in vitro experiments are used to determine the relative biological effectiveness (RBE) of liver and cancer cells in our mixed neutron and gamma fi eld. We work with alanine detectors in combination with Monte Carlo simulations, where we can measure and characterize the dose. To verify our calculations we perform neutron fl ux measurements using gold foil activation and pin-diodes . Material and methods . When L- α -alanine is irradiated with ionizing …

inorganic chemicalsPhysics::Instrumentation and DetectorsQuantitative Biology::Tissues and OrgansPhysics::Medical PhysicsBoron Neutron Capture TherapyValidation Studies as TopicModels BiologicalIonizing radiationTRIGAHospitals UniversityNuclear ReactorsCell Line TumorGermanyRelative biological effectivenessMedicineDosimetryHumansRadiology Nuclear Medicine and imagingNeutronNeutronsbusiness.industryRadiotherapy Planning Computer-AssistedRadiochemistryLiver NeoplasmsRadiotherapy DosageHematologyGeneral MedicineHep G2 CellsNeutron temperatureNeutron captureOncologyGamma RaysAbsorbed dosebusinessNuclear medicineColorectal Neoplasms
researchProduct

EPR DOSIMETRY IN A MIXED NEUTRON AND GAMMA RADIATION FIELD

2004

Suitability of Electron Paramagnetic Resonance (EPR) spectroscopy for criticality dosimetry was evaluated for tooth enamel, mannose and alanine pellets during the 'international intercomparison of criticality dosimetry techniques' at the SILENE reactor held in Valduc in June 2002, France. These three materials were irradiated in neutron and gamma-ray fields of various relative intensities and spectral distributions in order to evaluate their neutron sensitivity. The neutron response was found to be around 10% for tooth enamel, 45% for mannose and between 40 and 90% for alanine pellets according their type. According to the IAEA recommendations on the early estimate of criticality accident a…

inorganic chemicalsSafety ManagementMaterials scienceQuality Assurance Health CareRadiation DosageRisk AssessmentSensitivity and Specificitylaw.inventionRadiation Protectionstomatognathic systemlawNuclear ReactorsRisk FactorsmedicineDosimetryHumansRadiology Nuclear Medicine and imagingNeutronIrradiationElectron paramagnetic resonanceSpectroscopyRadiometryNeutronsObserver VariationRadiationRadiological and Ultrasound Technologybusiness.industryRadiochemistryPublic Health Environmental and Occupational HealthElectron Spin Resonance SpectroscopyReproducibility of ResultsGeneral MedicineReference StandardsTooth enamelEPR DOSIMETRY MIXED NEUTRON AND GAMMA RADIATION FIELDstomatognathic diseasesmedicine.anatomical_structureCriticalityGamma RaysAbsorbed doseBody BurdenFranceNuclear medicinebusinessRadioactive Hazard ReleaseRelative Biological Effectiveness
researchProduct

La resistenza di interfaccia calcestruzzo poroso-terreni a grana fina per il consolidamento di pendii mediante trincee drenanti profonde

2022

Le trincee drenanti profonde rappresentano uno dei metodi più efficaci per la mitigazione del rischio da frana, in pendii con falda idrica. Esse sono realizzate mediante pannelli o pali secanti. Il riempimento è costituito di calcestruzzo poroso o materiale granulare. Se le trincee sono adeguatamente “innestate” nel terreno stabile e il materiale di riempimento ha sufficiente resistenza e rigidezza come il calcestruzzo poroso, si ha ulteriore in-cremento di resistenza a taglio per effetto shear keys, oltre a quello derivante dalla riduzione delle pressioni in-terstiziali. L’incremento di resistenza è dovuto sia alla resistenza all’interfaccia calcestruzzo–terreni sia a quella intrinseca del…

interface shear strengthPervious concreteSettore ICAR/07 - Geotecnicashear keys effect. Pervious concrete for deep trench drains used to stabilise slopes must simultaneously satisfy many requirements namely adequate hydraulic conductiv-ity adequate shear strength a few days after pour-ing capacity to act as a protective filter for soils in which the drain is installed good resistance to clog-ging and adequate residual hydraulic conductivity. The pervious concrete with appropriated mix-design can effectively satisfy all the abovementioned requirements. If the trenches depth is such that they intersect the sliding surface and if the trenches are adequate-ly "socket" in the layers of stable soil there is a fur-ther increase in shear strength due to the shear keys effect. This latter is in addition to the increase in shear strength resulting from the reduction of inter-stitial pressures that remains the principal scope of the draining trenches. Obviously the increase of shear strength due to the shear keys effect occurs if the trenches are filled with material that have enough strength and stiffness such as the porous concrete. In this case the beneficial effects of the draining trenches on stability are also due to the resistance at the concrete interface of the trench - soils and to the intrinsic resistance of the concrete at the area of the trench intersected by the sliding surface taken into consideration.The increase in resistance due to the shear keys effect can be very significant in relation to the thickness and interspace of the trenches. Results reported in the paper demonstrated that the interface fine grained soil-pervious concrete is higher than the residual shear strength of the soil.
researchProduct

INTERNAL AUDIT: DEFINING, OBJECTIVES, FUNCTIONS AND STAGES

2010

This article aims, through a detailed presentation as to provide clarification for a better understanding of what internal audit definition, objectives, functions and stages of its development mean. It is also exposed a brief history about the emergence and development of internal audit and regulatory framework. I also plan to linking theory and practice by reference to documents used: both the evidence considered and especially those prepared by the auditors in connection with the performance audit and its use in the audit report.

internal audit efficiency effectiveness risk audit system audit performance audit regularity audithealth services administrationStudies in Business and Economics
researchProduct

Tehokkuuden subjektiivinen konstruointi julkishallinnon työntekijöiden puheessa – organisaatioestetiikka viitekehyksenä

2020

This study examines the employees’ everyday experiences at work. The goal is to encourage the emancipation from the limitations of rationality cultivating an aesthetic understanding of organizations. It seeks to answer how organization members construct their experiences of efficiency based on the dualism between aesthetic and rationality and how are these constructions related. This study also seeks to ansewer what kind of dynamics discourses on effectiviness deliver and maintain. The empirical data is obtained by interviews with public sector employees and interpreted using deconstructive analysis presented by David Boje. Based on the research interviews the strong reliance on rationality…

johtamispuhejohtaminensubjektiivinen kokemusaesthetic knowledgetehokkuuspublic managementretoriikkasubjective feelingtyöntekijätrationaalisuusjulkinen hallintoArtikkelitorganisaatioestetiikkaorganizational effectivenessHallinnon Tutkimus
researchProduct

Consumption behavior of eco-friendly products and applications of ICT innovation

2021

The purchase of eco-friendly products is encouraged by the governments due to its contributions to the sustainable development of the environment. It is therefore important to examine factors influencing the purchase of eco-friendly products. Based on the attitude-behavior-context (ABC) theory, this paper constructs a conceptual model, which explores how a consumer’s perceived effectiveness affects individuals’ purchase of eco-friendly products. In details, this paper attempts to examine the mediating role of consumption attitude of eco-friendly products, as well as the moderating effect of applications of information and communication technologies (ICT) innovation. Moreover, by building a …

kestävä kulutusperceived effectivenessconsumer attitudeICTkulutustottumuksettieto- ja viestintätekniikkaeco-friendly productkuluttajakäyttäytyminensustainabilityympäristöystävälliset tuotteetconsumption behavior
researchProduct

From accrued to paid income tax: A review of effective tax rate calculation

2019

Los estudios que han tratado de valorar la presión fiscal de una sociedad como consecuencia del impuesto sobre sociedades recurren generalmente al impuesto devengado como aproximación, aun sabiendo que difícilmente coincidirá con la cantidad verdaderamente pagada. Sin embargo, como consecuencia de los cambios producidos en las cuentas anuales para su adaptación a la normativa internacional, contamos con una información adicional en el balance (activos y pasivos fiscales) que hace posible obtener el importe del impuesto sobre beneficios pagado por las empresas, pudiendo medir de forma más precisa su verdadera presión fiscal. Teniendo en cuenta esta circunstancia y que ya disponemos de inform…

lcsh:Accounting. BookkeepingTax burden:6 - Ciencias aplicadas::65 - Gestión y organización. Administración y dirección de empresas. Publicidad. Relaciones públicas. Medios de comunicación de masas [CDU]Tipo impositivo efectivoAccountingPresión fiscalContabilización del impuesto sobre beneficioslcsh:Financelcsh:HG1-9999lcsh:HF5601-5689Accounting for income taxAverage effective tax rateRevista de Contabilidad
researchProduct

Antecedents of daily team job crafting

2017

This study investigated potential antecedents of team job crafting defined as the extent to which team members engage together in increasing (social and structural) job resources and challenges, and decreasing hindering job demands. Mindful of the teamwork literature, we hypothesized that individual employee factors (self-efficacy for teamwork, daily affect), team features (team cohesion, climate) and the organizational context of teams (engaging leadership and organizational resources for teamwork) relate positively to daily team job crafting behaviour. Data were collected among 46 multi-professional rehabilitation teams whose members completed two daily surveys after their weekly meetings…

leadershipOrganizational Behavior and Human Resource Managementmedia_common.quotation_subjectApplied psychologyPsychological interventionTeam effectiveness050109 social psychologyPsychological safetyAffect (psychology)teamsJob craftingproactive behaviour0502 economics and businessTaverne0501 psychology and cognitive sciencesJob craftingta515Applied Psychologymedia_commonTeam compositionTeamworkComputingMilieux_THECOMPUTINGPROFESSION05 social sciencesCohesion (linguistics)antecedentsPsychologySocial psychology050203 business & management
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Life Skills e formazione iniziale dei docenti

2022

challenges of everyday life. Learning to live involves acquiring many skills, for which in some cases there is a natural predisposition, but which always require a "guided" exercise in real life contexts so that the person acquires the skills necessary to "live properly". The research was conducted with a group of 153 students from the Master of Science in Primary Education, who participated in a two-year training project during the academic years 2020-21 and 2021-22. This article describes whether and to what extent the students believe they have developed the four chosen life skills and which of the training methodologies adopted by the lecturers were most effective.

life skills growth awareness sustainable skills effective methodologiesSettore M-PED/03 - Didattica E Pedagogia Speciale
researchProduct