Search results for " engineering"

showing 10 items of 38291 documents

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Tuning of Emission Wavelength of CaS:Eu by Addition of Oxygen Using Atomic Layer Deposition

2021

| openaire: EC/H2020/820423/EU//S2QUIP | openaire: EC/H2020/834742/EU//ATOP | openaire: EC/H2020/965124/EU//FEMTOCHIP Atomic layer deposition (ALD) technology has unlocked new ways of manipulating the growth of inorganic materials. The fine control at the atomic level allowed by ALD technology creates the perfect conditions for the inclusion of new cationic or anionic elements of the already-known materials. Consequently, novel material characteristics may arise with new functions for applications. This is especially relevant for inorganic luminescent materials where slight changes in the vicinity of the luminescent centers may originate new emission properties. Here, we studied the lumines…

sulfiditkalsiumTechnologyMicroscopyQC120-168.85Eu [CaS]TQH201-278.5CaS:Eu; phosphor; photoluminescence; atomic layer depositionatomikerroskasvatusharvinaiset maametallitEngineering (General). Civil engineering (General)ArticlephosphorTK1-9971Descriptive and experimental mechanicsatomic layer depositionCaS:EuphotoluminescenceElectrical engineering. Electronics. Nuclear engineeringohutkalvotTA1-2040fotoluminesenssifosforiMaterials
researchProduct

Surrogate Modelling for Oxygen Uptake Prediction Using LSTM Neural Network

2023

Oxygen uptake (V˙O2) is an important metric in any exercise test including walking and running. It can be measured using portable spirometers or metabolic analyzers. Those devices are, however, not suitable for constant use by consumers due to their costs, difficulty of operation and their intervening in the physical integrity of their users. Therefore, it is important to develop approaches for the indirect estimation of V˙O2-based measurements of motion parameters, heart rate data and application-specific measurements from consumer-grade sensors. Typically, these approaches are based on linear regression models or neural networks. This study investigates how motion data contribute to V˙O2 …

suorituskyky113 Computer and information sciencesBiochemistryAtomic and Molecular Physics and OpticsAnalytical ChemistryLSTM neural networkjuoksumittausmenetelmätoxygen uptakemachine learninghappikoneoppiminenmittarit (mittaus)Electrical and Electronic EngineeringINS/GPSInstrumentationrunning metricshapenotto
researchProduct

Copper-hydride nanoclusters with enhanced stability by N-heterocyclic carbenes

2021

AbstractCopper-hydrides have been intensively studied for a long time due to their utilization in a variety of technologically important chemical transformations. Nevertheless, poor stability of the species severely hinders its isolation, storage and operation, which is worse for nano-sized ones. We report here an unprecedented strategy to access to ultrastable copper-hydride nanoclusters (NCs), namely, using bidentate N-heterocyclic carbenes as stabilizing ligands in addition to thiolates. In this work, a simple synthetic protocol was developed to synthesize the first large copper-hydride nanoclusters (NCs) stabilized by N-heterocyclic carbenes (NHCs). The NC, with the formula of Cu31(RS)2…

superatomMaterials scienceSuperatomkuparistabilityCondensed Matter PhysicsAtomic and Molecular Physics and OpticsFourier transform ion cyclotron resonancecopper-hydrideNanoclustersN-heterocylic carbeneCrystallographychemistry.chemical_compoundklusteritUltraviolet visible spectroscopymetal clusterschemistryCluster (physics)Copper hydrideGeneral Materials ScienceThermal stabilityDensity functional theorynanohiukkasetElectrical and Electronic Engineering
researchProduct

Thiol-Stabilized Atomically Precise, Superatomic Silver Nanoparticles for Catalyzing Cycloisomerization of Alkynyl Amines

2018

Abstract Both the electronic and surface structures of metal nanomaterials play critical roles in determining their chemical properties. However, the non-molecular nature of conventional nanoparticles makes it extremely challenging to understand the molecular mechanism behind many of their unique electronic and surface properties. In this work, we report the synthesis, molecular and electronic structures of an atomically precise nanoparticle, [Ag206L72]q (L = thiolate, halide; q = charge). With a four-shell Ag7@Ag32@Ag77@Ag90 Ino-decahedral structure having a nearly perfect D5h symmetry, the metal core of the nanoparticle is co-stabilized by 68 thiolate and 4 halide ligands. Both electroche…

superatomMaterials sciencemetal nanoclustersatomically precise nanoparticlesNanoparticle02 engineering and technology010402 general chemistryPhotochemistry01 natural sciencesSilver nanoparticleNanomaterialsCycloisomerizationjalometallitReactivity (chemistry)ta116PlasmonMultidisciplinaryta114Superatom021001 nanoscience & nanotechnologynanocatalysisnobel metal0104 chemical sciencesDensity functional theorynanohiukkaset0210 nano-technologyNational Science Review
researchProduct

Thermoelectric radiation detector based on a superconductor-ferromagnet junction : Calorimetric regime

2018

We study the use of a thermoelectric junction as a thermal radiation detector in the calorimetric regime, where single radiation bursts can be separated in time domain. We focus especially on the case of a large thermoelectric figure of merit ZT affecting significantly, for example, the relevant thermal time scales. This work is motivated by the use of hybrid superconductor/ferromagnet systems in creating an unprecedentedly high low-temperature ZT even exceeding unity. Besides constructing a very general noise model which takes into account cross correlations between charge and heat noise, we show how the detector signal can be efficiently multiplexed by the use of resonant LC circuits givi…

superconducting filmsthermodynamic measurements and instrumentationradiation detectorssignaalinkäsittelyilmaisimetinductorsferromagnetic materialsquasiparticlelämpösäteilytelecommunications engineeringfononitsuprajohteet
researchProduct

Flat-band superconductivity in strained Dirac materials

2016

We consider superconducting properties of a two-dimensional Dirac material such as graphene under strain that produces a flat band spectrum in the normal state. We show that in the superconducting state, such a model results in a highly increased critical temperature compared to the case without the strain, inhomogenous order parameter with two-peak shaped local density of states and yet a large and almost uniform and isotropic supercurrent. This model could be realized in strained graphene or ultracold atom systems and could be responsible for unusually strong superconductivity observed in some graphite interfaces and certain IV-VI semiconductor heterostructures.

superconducting propertiesMaterials sciencesuprajohtavuusDirac (software)FOS: Physical sciences02 engineering and technology01 natural scienceslaw.inventionsuprajohteetSuperconductivity (cond-mat.supr-con)Condensed Matter::Materials SciencelawUltracold atompuolijohteetCondensed Matter::Superconductivity0103 physical sciencesgrafeeniGraphite010306 general physicsSuperconductivityLocal density of statesCondensed matter physicsta114Dirac materialsGrapheneCondensed Matter - SuperconductivityIsotropySupercurrent021001 nanoscience & nanotechnology0210 nano-technologyPhysical Review B
researchProduct

Superconducting Triplet Rim Currents in a Spin-Textured Ferromagnetic Disk

2022

Since the discovery of the long-range superconducting proximity effect, the interaction between spin-Triplet Cooper pairs and magnetic structures such as domain walls and vortices has been the subject of intense theoretical discussions, while the relevant experiments remain scarce. We have developed nanostructured Josephson junctions with highly controllable spin texture, based on a disk-shaped Nb/Co bilayer. Here, the vortex magnetization of Co and the Cooper pairs of Nb conspire to induce long-range triplet (LRT) superconductivity in the ferromagnet. Surprisingly, the LRT correlations emerge in highly localized (sub-80 nm) channels at the rim of the ferromagnet, despite its trivial band s…

suprajohtavuusCondensed Matter - SuperconductivityMechanical EngineeringFOS: Physical sciencesnanotekniikkaBioengineeringGeneral ChemistryCondensed Matter Physics114 Physical sciencessuprajohteetSuperconductivity (cond-mat.supr-con)General Materials SciencemagnetismifysiikkaNano Letters
researchProduct

Topological polarization, dual invariants, and surface flat band in crystalline insulators

2020

We describe a three-dimensional crystalline topological insulator (TI) phase of matter that exhibits spontaneous polarization. This polarization results from the presence of (approximately) flat bands on the surface of such TIs. These flat bands are a consequence of the bulk-boundary correspondence of polarized topological media, and contrary to related nodal line semimetal phases also containing surface flat bands, they span the entire surface Brillouin zone. We also present an example Hamiltonian exhibiting a Lifshitz transition from the nodal line phase to the TI phase with polarization. Utilizing elasticity tetrads, we show a complete classification of 3D crystalline TI phases and invar…

suprajohtavuusFOS: Physical sciences02 engineering and technologyTopology01 natural sciencessähkönjohtavuussymbols.namesakeHall effectPhase (matter)0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)kvanttifysiikka010306 general physicsPhysicsSuperconductivityCondensed Matter - Materials ScienceCondensed Matter - Mesoscale and Nanoscale PhysicsnanoelektroniikkaMaterials Science (cond-mat.mtrl-sci)kiteet021001 nanoscience & nanotechnologyPolarization (waves)SemimetalBrillouin zoneTopological insulatorsymbols0210 nano-technologyHamiltonian (quantum mechanics)
researchProduct

Finite-frequency spin susceptibility and spin pumping in superconductors with spin-orbit relaxation

2020

Static spin susceptibility of superconductors with spin-orbit relaxation has been calculated in the seminal work of A.A. Abrikosov and L.P. Gor'kov [Sov. Phys. JETP, {\bf 15}, 752 (1962)]. Surprisingly the generalization of this result to finite frequencies has not been done despite being quite important for the modern topic of superconducting spintronics. The present paper fills this gap by deriving the analytical expression for spin susceptibility. The time-dependent spin response is shown to be captured by the quasiclassical Eilenberger equation with collision integrals corresponding to the ordinary and spin-orbit scattering. Using the developed formalism we study the linear spin pumping…

suprajohtavuusFOS: Physical sciences02 engineering and technologyspin dynamics01 natural sciencessuprajohteetSuperconductivity (cond-mat.supr-con)Condensed Matter::Superconductivity0103 physical sciences010306 general physicsPhysicsSuperconductivityspintronicsSpin pumpingSpintronicsCondensed matter physicsScatteringCondensed Matter - Superconductivity021001 nanoscience & nanotechnologyspin relaxationspin-orbit couplingFormalism (philosophy of mathematics)Ferromagnetismspin (kvanttimekaniikka)Condensed Matter::Strongly Correlated Electrons0210 nano-technology
researchProduct