Search results for " event"

showing 10 items of 872 documents

Long-term effects on adult attachment in German occupation children born after World War II in comparison with a birth-cohort-matched representative …

2016

Children born of war are a phenomenon of every conflict. At the end of World War II and thereafter, approximately 400,000 children were fathered by foreign soldiers and born to local women in Germany. Quantitative research on psychosocial consequences of growing up as German occupation child (GOC) has been missing so far.This study examines adult attachment and its association with current depression in GOC (N = 146) using self-report instruments: Adult Attachment Scale, Patient Health Questionnaire. Data were compared to a birth-cohort-matched representative sample of the German population (BCMS; N = 786).GOC differ in both attachment dimensions (less comfortable with closeness/intimacy, l…

AdultMalemedicine.medical_specialtyWorld War IIPopulationPsychological Techniques050109 social psychologyGermanLife Change Events03 medical and health sciences0302 clinical medicineGermanymedicineHumans0501 psychology and cognitive sciencesPsychiatryeducationChildObject Attachmenteducation.field_of_studyPovertyDepression05 social sciencesWorld War IIObject Attachmentlanguage.human_language030227 psychiatryPatient Health QuestionnairePsychiatry and Mental healthAdult Survivors of Child Adverse EventslanguageLife course approachFemaleGeriatrics and GerontologyPshychiatric Mental HealthPsychologyGerontologyPsychosocialAgingmental health
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Able or unable to work? : Life trajectory after severe occupational injury

2018

Purpose: To study the probabilities and permanence of return to work, inability to work and rehabilitation, and to explore the connection between these life situations and later working after a sev...

AdultMalework disability030506 rehabilitationAdolescentKansanterveystiede ympäristö ja työterveys - Public health care science environmental and occupational healthmedicine.medical_treatmentOccupational injuryApplied psychologyKansantaloustiede - EconomicsReturn to workrehabilitationCohort StudiesLife Change EventsYoung Adult03 medical and health sciencesInjury Severity ScoreReturn to Work0302 clinical medicinemedicineHumansDisabled PersonsRegistriesFinlandAgedRetirementRehabilitationWork disabilityRehabilitationAge Factorsoccupational injuriesreturn to workMiddle Agedmedicine.diseaseOccupational InjuriesWork lifeConnection (mathematics)Work (electrical)UnemploymentIncomeTrajectoryFemale0305 other medical sciencePsychology030217 neurology & neurosurgery
researchProduct

Coping strategies and postpartum depressive symptoms: A structural equation modelling approach

2015

BACKGROUND: Variables such as the mother's personality, social support, coping strategies and stressful events have been described as risk factors for postpartum depression. Structural Equation Modelling (SEM) analysis was used to examine whether neuroticism, perceived social support, perceived life events, and coping strategies are associated with postpartum depressive symptoms at the 8th and 32nd weeks. METHODS: A total of 1626 pregnant women participated in a longitudinal study. Different evaluations were performed 8 and 32weeks after delivery. Several measures were used: the Edinburgh Postnatal Depression Scale (EPDS), the Diagnostic Interview for Genetic Studies (DIGS), the Eysenck Per…

AdultNeuroticismDepressionPostpartum PeriodStatistics as TopicPsychological TechniquesSocial SupportLife events/StressPersonality AssessmentPrognosisAnxiety DisordersDepression PostpartumLife Change EventsPredictive Value of TestsPregnancyRisk FactorsPostpartumAdaptation PsychologicalHumansFemaleLongitudinal StudiesCopingStress Psychological
researchProduct

Association Between ABCB1 Genetic Variants and Persistent Chemotherapy-Induced Alopecia in Women With Breast Cancer

2020

Importance Persistent chemotherapy-induced alopecia (pCIA) has been recently described in patients with breast cancer and in its most severe form occurs in up to 10% of these patients. Genetic risk factors associated with pCIA have not been adequately explored. Objective To identify genetic variants associated with pCIA. Design, Setting, and Participants In this genetic association study, 215 women with breast cancer treated with docetaxel-based chemotherapy with a follow-up of 1.5 to 10 years after the end of the treatment were recruited retrospectively through 3 hospital oncology units across Spain between 2005 and 2018. Severe pCIA was defined as lack of scalp hair recovery (Common Termi…

AdultOncologymedicine.medical_specialtyATP Binding Cassette Transporter Subfamily BBiopsyBreast NeoplasmsGenome-wide association studyDocetaxelDermatologyPolymorphism Single Nucleotide030207 dermatology & venereal diseases03 medical and health sciences0302 clinical medicineBreast cancerRisk FactorsInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineHumansGenetic Predisposition to DiseasePromoter Regions GeneticAdverse effectRetrospective StudiesDose-Response Relationship Drugbusiness.industryAge FactorsCase-control studyAlopeciaCommon Terminology Criteria for Adverse EventsRetrospective cohort studyOdds ratioMiddle Agedmedicine.diseaseEnhancer Elements GeneticDocetaxelCase-Control Studies030220 oncology & carcinogenesisFemalebusinessHair FollicleFollow-Up StudiesGenome-Wide Association Studymedicine.drugJAMA Dermatology
researchProduct

Interactive effects of avoidant coping and parental hypertension on Rate Pressure Product reactivity in women

2005

Background: Previous research suggests that personality, situational context variables, and genes might interact to potentiate cardiovascular stress responses.Purpose: Our purpose is to examine interactive effects of dispositional avoidant coping and parental hypertension on cardiovascular reactivity to three different laboratory stressors.Method: Participants were 63 healthy female students. Stressors were an evaluated videotaped speech, the cold pressor, and viewing of the speech video. Heart rate and blood pressure were continuously recorded during baselines and tasks.Results: After controlling for age, body mass index, smoking status, reported exercise, alcohol consumption, oral contrac…

AdultParentsHealth Statusmedia_common.quotation_subjectStressorCold pressor testVideotape RecordingPersonality DisordersDevelopmental psychologyLife Change EventsPsychiatry and Mental healthRate pressure productBlood pressureAdaptation PsychologicalHypertensionBehavioral medicineVisual PerceptionHumansPersonalityFemalePsychologyReactivity (psychology)Body mass indexGeneral Psychologymedia_commonAnnals of Behavioral Medicine
researchProduct

Associations between parental alcohol problems in childhood and adversities during childhood and later adulthood: a cross-sectional study of 28047 ad…

2021

Abstract Background Adverse childhood experiences (ACE) are related to adverse physical and mental health outcomes. However, few larger studies based on a general population sample with age groups ranging from young adults to elderly have investigated whether parental alcohol problems increase the risk of offspring subjective reports of ACE both during childhood and current adult adversities. The purpose of this study was to examine the associations between parental alcohol problems and adversities during childhood and later in adulthood. Methods The 28,047 respondents were adults (> 18 years old) from the general population who participated in the Norwegian Counties Public Health Survey…

AdultParentsmedicine.medical_specialtyAdolescentCross-sectional studyPopulation030508 substance abuseAlcohol drinkingDysfunctional family03 medical and health sciences0302 clinical medicineSocial pathology. Social and public welfare. CriminologyAdverse Childhood ExperiencesRisk FactorsHumansMedicineFamily030212 general & internal medicineYoung adulteducationHV1-9960Agededucation.field_of_studybusiness.industryResearchHealth PolicyPublic healthOdds ratioMental healthVDP::Medical disciplines: 700Psychiatry and Mental healthHealth psychologyCross-Sectional StudiesAdult survivors of child adverse eventsPublic aspects of medicineRA1-12700305 other medical sciencebusinessAlcohol-Related DisordersDemographySubstance Abuse Treatment, Prevention, and Policy
researchProduct

Long-term consequences of polycystic ovary syndrome on cardiovascular risk

2009

Most available data suggest that the prevalence of cardiovascular diseases in women with polycystic ovary syndrome (PCOS) is smaller than expected based on risk calculations during fertile years; therefore, more studies are needed on long-term cardiovascular consequences. Evidence is accumulating that postmenopausal women with PCOS have an increased risk of cerebrovascular events and cardiovascular morbidity. These events are partially related to persisting hyperandrogenism but are mostly correlated with excessive body weight (mainly visceral obesity); this suggests that our best long-term strategy is to ensure that women with PCOS are informed about their high risk for metabolic and cardio…

AdultPolycystic ovary syndrome cardiovascular risk menopause eventsAgingPediatricsmedicine.medical_specialty10265 Clinic for Endocrinology and Diabetology610 Medicine & healthBody weightDiabetes ComplicationsRisk FactorsmedicineHumansCystObesityAgedAged 80 and overGynecologyPostmenopausal womenbusiness.industryHyperandrogenismObstetrics and Gynecology2729 Obstetrics and Gynecology2743 Reproductive MedicineMiddle Agedmedicine.diseasePolycystic ovaryMenopauseC-Reactive ProteinIncreased riskReproductive MedicineCardiovascular DiseasesAndrogensFemaleAdiponectinHyperandrogenismbusinessBiomarkersVisceral ObesityPolycystic Ovary Syndrome
researchProduct

Prevalence of Parental Alcohol Problems among a General Population Sample of 28,047 Norwegian Adults: Evidence for a Socioeconomic Gradient

2021

The aim of the study presented here was to estimate the prevalence of parental alcohol problems during childhood in a general population of Norwegian adults, and to investigate associations between parental alcohol problems during childhood and lower socioeconomic status in adulthood. This cross-sectional study recruited 28,047 adults (≥18 years) to an online health survey (Norwegian Counties Public Health Surveys). We evaluated demographic and socioeconomic measures and responses to a shortened version of the Children of Alcoholics Screening Test (CAST-6) scale to assess whether respondents perceived parental alcohol consumption during childhood as problematic. Respondents reported parenta…

Adultmedicine.medical_specialtyHealth Toxicology and MutagenesisPopulationprevalencePsychological interventionNorwegianLogistic regressionArticle03 medical and health sciences0302 clinical medicineRisk FactorsMedicineHumans030212 general & internal medicineeducationChildSocioeconomic statuseducation.field_of_studyadult survivors of adverse life eventsbusiness.industryNorwayPublic healthsocial gradientRPublic Health Environmental and Occupational HealthOdds ratioConfidence intervallanguage.human_language030227 psychiatryparental alcohol useCross-Sectional StudiesChildren of Alcoholics Screening Test (CAST-6)VDP::Medisinske Fag: 700::Helsefag: 800Social ClasslanguageMedicinebusinessAlcohol-Related DisordersDemographyInternational Journal of Environmental Research and Public Health
researchProduct

Older age and markers of inflammation are strong predictors of clinical events in women with asymptomatic carotid lesions

2007

OBJECTIVE: Limited information exists regarding the association between markers of inflammation, such as high-sensitivity C-reactive protein (hs-CRP) and fibrinogen, and adverse events in postmenopausal women with subclinical atherosclerosis. Therefore, we investigated the prognostic impact of traditional risk factors and inflammation on adverse cardiac events in women with asymptomatic carotid lesions. DESIGN: We studied 250 postmenopausal women who were free of cardiovascular disease. Traditional cardiovascular risk factors were investigated, and laboratory analysis included measurement of plasma lipids, fibrinogen, and hs-CRP. The early phases of carotid atherosclerosis were assessed by …

Adultmedicine.medical_specialtyPathologySettore MED/09 - Medicina Internaclinical eventsMyocardial InfarctionmenopauseInflammationFibrinogenAsymptomaticcarotid atherosclerosiRisk FactorsInternal medicineOdds RatiomedicineHumansMyocardial infarctionAdverse effectStrokeAgedbiologybusiness.industryC-reactive proteinAge FactorsFibrinogenObstetrics and GynecologyOdds ratioMiddle AgedAtherosclerosismedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareStrokeC-Reactive ProteinCarotid Arteriesinflammationbiology.proteinFemaleRisk factormedicine.symptomTunica IntimaTunica MediabusinessBiomarkersFollow-Up Studiesmedicine.drugMenopause
researchProduct