Search results for " fluid"

showing 10 items of 3232 documents

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Charge breeding at GANIL: Improvements, results, and comparison with the other facilities

2019

International audience; The 1+/n+ method, based on an ECRIS charge breeder (CB) originally developed at the LPSC laboratory, is now implemented at GANIL for the production of Radioactive Ion Beams (RIBs). Prior to its installation in the middle of the low energy beam line of the SPIRAL1 facility, the 1+/n+ system CB has been modified based on the experiments performed on the CARIBU Facility at Argone National Laboratory. Later, it has been tested at the 1+/n+ LPSC test bench to validate its operation performances. Charge breeding efficiencies as well as charge breeding times have been measured for noble gases and alkali elements. The commissioning phase started at GANIL in the second half-y…

010302 applied physicsPhysicsTest benchRange (particle radiation)mechanical instrumentstutkimuslaitteetCyclotronThermal ionization01 natural sciences7. Clean energyIon source010305 fluids & plasmaslaw.inventionNuclear physicsion sourcesUpgradeBreeder (animal)Beamlinenuclear physicslawion beam mass spectrometer0103 physical sciences[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]ydinfysiikkaInstrumentation
researchProduct

Self-consistent non-stationary theory of the gyrotron

2016

For a long time, the gyrotron theory was developed assuming that the transit time of electrons through the interaction space is much shorter than the cavity fill time. Correspondingly, it was assumed that during this transit time, the amplitude of microwave oscillations remains constant. A recent interest to such additional effects as the after-cavity interaction between electrons and the outgoing wave in the output waveguide had stimulated some studies of the beam-wave interaction processes over much longer distances than a regular part of the waveguide which serves as a cavity in gyrotrons. Correspondingly, it turned out that the gyrotron theory free from the assumption about constant amp…

010302 applied physicsPhysicsWaveguide (electromagnetism)Plane (geometry)ElectronCondensed Matter Physics01 natural sciences010305 fluids & plasmaslaw.inventionMagnetic fieldAmplitudelawGyrotronQuantum electrodynamicsQuantum mechanics0103 physical sciencesConstant (mathematics)MicrowavePhysics of Plasmas
researchProduct

Effects of magnetic configuration on hot electrons in a minimum-B ECR plasma

2020

International audience; To investigate the hot electron population and the appearance of kinetic instabilities in highly charged electron cyclotron resonance ion source (ECRIS), the axially emitted bremsstrahlung spectra and microwave bursts emitted from ECRIS plasma were synchronously measured on SECRAL-II (Superconducting ECR ion source with Advanced design in Lanzhou No. II) ion source with various magnetic field configurations. The experimental results show that when the ratio of the minimum field to the resonance field (i.e. Bmin/Becr ) is less than ~0.8, the bremsstrahlung spectral temperature Ts increases linearly with the Bmin/Becr –ratio when the injection, extraction and radial mi…

010302 applied physicsPhysics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceBremsstrahlungResonancePlasmaCondensed Matter Physics01 natural sciencesElectromagnetic radiationElectron cyclotron resonance010305 fluids & plasmasMagnetic fieldNuclear Energy and Engineering0103 physical sciencesAtomic physicsMicrowave
researchProduct

Hydrogen plasma induced photoelectron emission from low work function cesium covered metal surfaces

2017

Experimental results of hydrogen plasma induced photoelectron emission from cesium covered metal surfaces under ion source relevant conditions are reported. The transient photoelectron current during the Cs deposition process is measured from Mo, Al, Cu, Ta, Y, Ni, and stainless steel (SAE 304) surfaces. The photoelectron emission is 2–3.5 times higher at optimal Cs layer thickness in comparison to the clean substrate material. Emission from the thick layer of Cs is found to be 60%–80% lower than the emission from clean substrates. peerReviewed

010302 applied physicsPhysicsta114HydrogenTantalumAnalytical chemistrytransitionchemistry.chemical_elementSubstrate (electronics)plasmasCondensed Matter Physics01 natural sciencesIon sourcework functions010305 fluids & plasmasion sourceschemistryAluminiumCaesium0103 physical sciencesWork functionLayer (electronics)photoemissionPhysics of Plasmas
researchProduct

Cyclotron instability in the afterglow mode of minimum-B ECRIS.

2016

It was shown recently that cyclotron instability in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source (ECRIS) causes perturbation of the extracted ion current and generation of strong bursts of bremsstrahlung emission, which limit the performance of the ion source. The present work is devoted to the dynamic regimes of plasma instability in ECRIS operated in pulsed mode. Instability develops in decaying plasma shortly after heating microwaves are switched off and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high energy electrons. Time-resolved measurements of microwave emission bursts are presented. I…

010302 applied physicsPhysicsta114ta213Astrophysics::High Energy Astrophysical Phenomenaplasma instabilityCyclotronBremsstrahlungPlasma01 natural sciencesInstabilityIon sourceElectron cyclotron resonance010305 fluids & plasmaslaw.inventionTwo-stream instabilityPhysics::Plasma Physicslaw0103 physical scienceselectron cyclotron resonance ion sourcesAtomic physicsInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct

THE GYROTRON STARTUP SCENARIO IN THE SINGLE MODE TIME DEPENDENT APPROACH

2019

The paper explains how to solve the Gyrotron equation system in the Single Mode Time Dependent Approach. In particular, we point out problems encountered when solving these well-known equations. The starting current estimation approach a using time model is suggested. The solution has been implemented in the Matlab code, which is attached to the article.

010302 applied physicsPhysicstime dependent approachgyrotronNuclear engineeringSingle-mode optical fiberMatlab code01 natural sciences010305 fluids & plasmaslaw.inventiondifferential equationlawModeling and SimulationGyrotron0103 physical sciencesQA1-939MathematicsAnalysisMathematical Modelling and Analysis
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Spontaneous order in ensembles of rotating magnetic droplets

2019

Ensembles of elongated magnetic droplets in a rotating field are studied experimentally. In a given range of field strength and frequency the droplets form rotating structures with a triangular order - rotating crystals. A model is developed to describe ensembles of several droplets, taking into account the hydrodynamic interactions between the rotating droplets in the presence of a solid wall below the rotating ensemble. A good agreement with the experimentally observed periodic dynamics for an ensemble of four droplets is obtained. During the rotation, the tips of the elongated magnetic droplets approach close to one another. An expression is derived that gives the magnetic interaction be…

010302 applied physicsRange (particle radiation)Materials scienceField (physics)Dynamics (mechanics)Fluid Dynamics (physics.flu-dyn)FOS: Physical sciencesField strengthPhysics - Fluid Dynamics02 engineering and technologyCondensed Matter - Soft Condensed MatterSolid wall021001 nanoscience & nanotechnologyCondensed Matter PhysicsRotation01 natural sciencesMolecular physicsElectronic Optical and Magnetic MaterialsPhysics::Fluid DynamicsColloid0103 physical sciencesPhysics::Atomic and Molecular ClustersSoft Condensed Matter (cond-mat.soft)Self-assembly0210 nano-technology
researchProduct

An Experimental Study of Waveguide Coupled Microwave Heating with Conventional Multicusp Negative Ion Source

2015

Negative ion production with conventional multicusp plasma chambers utilizing 2.45 GHz microwave heating is demonstrated. The experimental results were obtained with the multicusp plasma chambers and extraction systems of the RFdriven RADIS ion source and the filament driven arc discharge ion source LIISA. A waveguide microwave coupling system, which is almost similar to the one used with the SILHI ion source, was used. The results demonstrate that at least one third of negative ion beam obtained with inductive RF-coupling (RADIS) or arc discharge (LIISA) can be achieved with 1 kW of 2.45 GHz microwave power in CW mode without any modification of the plasma chamber. The co-extracted electro…

010302 applied physicsWaveguide (electromagnetism)Materials scienceFOS: Physical sciencesPlasmaElectron7. Clean energy01 natural sciencesIon sourcePhysics - Plasma Physics010305 fluids & plasmasIonPlasma Physics (physics.plasm-ph)Electric arcPhysics::Plasma Physics0103 physical sciencesAtomic physicsMicrowaveBeam (structure)
researchProduct