Search results for " frequency"

showing 10 items of 1398 documents

Differences in visual performance of AcrySof ReSTOR IOL in high and low myopic eyes.

2009

PURPOSE To determine the differences in refractive and visual results obtained in eyes with high and low myopia after multifocal intraocular lens (IOL) implantation. METHODS Monocular visual acuity for distance and near, with and without distance correction, and photopic and mesopic contrast sensitivity were measured at 6 months after surgery in 152 myopic eyes implanted with the AcrySof ReSTOR Natural (SN60D3) IOL. Two groups were created: high and low myopia (76 eyes in each). RESULTS Monocular best distance-corrected visual acuity was 0.02+/-0.06 logMAR for low myopes and 0.05+/-0.09 logMAR for high myopes. Monocular best distance-corrected near visual acuity was 0.04+/-0.05 and 0.07+/-0…

AdultMalemedicine.medical_specialtyVisual acuitygenetic structuresPseudophakiaMesopic visionmedia_common.quotation_subjectProsthesis DesignRefraction OcularSeverity of Illness IndexContrast Sensitivity03 medical and health sciences0302 clinical medicineLens Implantation IntraocularOphthalmologymedicineMyopiaContrast (vision)HumansProspective Studiesmedia_commonAgedLenses IntraocularMonocularbusiness.industryGeneral MedicineMultifocal intraocular lensMiddle AgedDistance correctioneye diseasesOphthalmologyTreatment Outcome030221 ophthalmology & optometryFemalesense organsSpatial frequencymedicine.symptombusiness030217 neurology & neurosurgeryPhotopic visionEuropean journal of ophthalmology
researchProduct

Sex differences in allelic frequencies of the 5-HT2C Cys23Ser polymorphism in psychiatric patients and healthy volunteers: findings from an associati…

2000

Polymorphisms in the serotonergic system are believed to play a role in the etiology and treatment of different psychiatric illnesses. The 5-HT2C receptor gene is X-linked, with a frequent mutation at nucleotide 68 leading to a Ser-->Cys transition at amino acid 23. Recent studies have demonstrated an impaired function of 5-HT2C receptors and an increased production of the major noradrenergic metabolite 3-methoxy-4-hydroxyphenylethyleneglycol in the cerebrospinal fluid among the subjects carrying the Ser23 allele (Lappalainen et al., 1999). Biol. Psychiatry 46:821). We genotyped patients with alcohol dependence, panic disorder without agoraphobia, generalized anxiety disorder, narcolepsy an…

AdultMalemedicine.medical_specialtyX ChromosomeGeneralized anxiety disorderGene FrequencyReference ValuesGenotypeReceptor Serotonin 5-HT2CSerineGeneticsmedicineHumansCysteineAllelePsychiatryAllele frequencyAllelesBiological PsychiatryGenetics (clinical)NarcolepsySex CharacteristicsPolymorphism Geneticbusiness.industryMental DisordersPanic disorderAlcohol dependenceMiddle Agedmedicine.diseaseAnxiety DisordersAlcoholismPsychiatry and Mental healthAmino Acid SubstitutionReceptors SerotoninPanic DisorderFemalebusinessAgoraphobiaNarcolepsyPsychiatric Genetics
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

IL 10.G microsatellites mark promoter haplotypes associated with protection against the development of reactive arthritis in Finnish patients.

2001

Objective To investigate the association of microsatellites and single-nucleotide promoter polymorphisms (SNPs) in the gene for the cytokine interleukin-10 (IL-10) with susceptibility to and outcome of reactive arthritis (ReA). Methods From genomic DNA, IL-10 microsatellites G and R and IL-10 promoter polymorphisms at positions −1087 and −524 were typed by polymerase chain reaction, automated fragment length analysis, and restriction fragment digestion in 85 Finnish patients with ReA and 62 HLA–B27–positive Finnish controls. ReA patients had been followed up for 20 years. Genotypes and haplotypes of IL-10 were correlated with distinct features of the disease course, such as triggering agent…

AdultMalemusculoskeletal diseasesGenetic LinkageImmunologySingle-nucleotide polymorphismArthritis ReactivePolymorphism Single NucleotideRestriction fragmentRheumatologyProhibitinsGenotypeHumansImmunology and AllergyPharmacology (medical)AllelePromoter Regions GeneticAllele frequencyFinlandGeneticsbiologyreactive arthritis IL-10 microsatellites polymorphismHaplotypeMiddle AgedInterleukin-10HaplotypesImmunologybiology.proteinMicrosatelliteFemaleRestriction fragment length polymorphismFollow-Up StudiesMicrosatellite Repeats
researchProduct

No primary association between LMP2 polymorphisms and extraspinal manifestations in spondyloarthropathies

1997

OBJECTIVE—To investigate the potential role of the HLA-linked LMP2 (low molecular weight protein) gene polymorphisms in conjunction with DR4 and DR7 on extraspinal disease manifestations in HLA-B27 positive patients with spondyloarthropathy.
METHODS—172 patients with spondyloarthropathy, 46 healthy, HLA-B27 positive blood donors, and 99 unrelated controls were typed for HLA-class I and II antigens. LMP2 alleles were determined by polymerase chain reaction and subsequent restriction enzyme digestion.
RESULTS—There were statistically non-significant increases of DR4 and DR7 in spondyloarthropathy subjects. However these differences did not relate to specific extraspinal manifestations. There …

AdultMalemusculoskeletal diseasesLinkage disequilibriumAdolescentSpondyloarthropathyImmunologyHLA-DR7 AntigenDiseaseGeneral Biochemistry Genetics and Molecular BiologyGenetic determinismUveitisPathogenesisRheumatologyCorrespondenceGenotypeHLA-DR4 Antigenotorhinolaryngologic diseasesmedicineHumansImmunology and AllergyAlleleskin and connective tissue diseasesHLA-B27 AntigenConcise ReportsAgedAged 80 and overPolymorphism Geneticbusiness.industryArthritisProteinsMiddle Agedmedicine.diseaseGenotype frequencyCysteine Endopeptidasesstomatognathic diseasesImmunologyFemaleSpinal DiseasesbusinessAnnals of the Rheumatic Diseases
researchProduct

Autoimmune polyglandular syndrome type 2 shows the same HLA class II pattern as type 1 diabetes†

2011

Autoimmune polyglandular syndrome (APS) type 2 is defined by the manifestation of at least two autoimmune endocrine diseases. Only few data exist on genetic associations of APS type 2. In this controlled study, 98 patients with APS type 2, 96 patients with type 1 diabetes (T1D), and 92 patients with autoimmune thyroid disease, both as a single autoimmune endocrinopathy, were tested for association with alleles of the human leukocyte antigen (HLA) class II loci DRB1, DQA1, and DQB1. Patients with APS type 2 had significantly more often the alleles DRB1*03 (P(c) < 0.0001), DRB1*04 (P(c) < 0.000005), DQA1*03 (P(c) < 0.0001), and DQB1*02 (P(c) < 0.05), when compared with controls. Less frequent…

AdultMalemusculoskeletal diseasesendocrine system diseasesImmunologyHuman leukocyte antigenDiseaseBiochemistryGene Frequencyimmune system diseasesDiabetes mellitusGeneticsmedicineHumansImmunology and AllergyEndocrine systemAllelePolyendocrinopathies Autoimmuneskin and connective tissue diseasesAllelesHLA-D AntigensType 1 diabetesbusiness.industryHaplotypenutritional and metabolic diseasesGeneral MedicineMiddle Agedmedicine.diseaseDiabetes Mellitus Type 1ImmunologyAutoimmune Polyglandular Syndrome Type 2FemalebusinessTissue Antigens
researchProduct

Synergy of spatial frequency and orientation bandwidth in texture segregation

2021

Defining target textures by increased bandwidths in spatial frequency and orientation, we observed strong cue combination effects in a combined texture figure detection and discrimination task. Performance for double-cue targets was better than predicted by independent processing of either cue and even better than predicted from linear cue integration. Application of a texture-processing model revealed that the oversummative cue combination effect is captured by calculating a low-level summary statistic (\(\Delta CE_m\)), which describes the differential contrast energy to target and reference textures, from multiple scales and orientations, and integrating this statistic across channels wi…

AdultMaleorientation bandwidthlocal energyComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISIONModels PsychologicalTexture (geology)Article050105 experimental psychologyContrast SensitivityYoung Adult03 medical and health sciences0302 clinical medicineHumans0501 psychology and cognitive sciencesDetection theorySensitivity (control systems)Orientation SpatialMathematicsspatial frequency bandwidthcue combinationOrientation (computer vision)Noise (signal processing)business.industry05 social sciencesPattern recognitionFilter (signal processing)Sensory SystemsOphthalmologyPattern Recognition VisualFemaleSpatial frequencyArtificial intelligencebusinesstexture segregation030217 neurology & neurosurgeryEnergy (signal processing)Journal of Vision
researchProduct

Identification of two novel polymorphisms and a rare deletion variant in the human dopamine D4 receptor gene

1995

We report two novel polymorphisms and a rare deletion variant in the human dopaine D4 receptor gene. The two polymorphisms are characterized by single base pair substitutions, namely a G-->C transversion changing codon 11 from GGG (encoding Gly) to CGG (encoding Arg) and a C-->T transition in position -11 upstream from the start codon. The Arg11 variant occurs at a frequency of about 1% and the C-->T transition at a frequency of about 7% in German control subjects (n = 148). Allele frequencies observed in patients suffering from schizophrenia (n = 256) and bipolar affective disorder (n = 99) were similar. The deletion variant is characterized by a 21 bp deletion affecting codons 36 to 42 co…

AdultObsessive-Compulsive DisorderBipolar DisorderMolecular Sequence DataBiologymedicine.disease_causePolymerase Chain ReactionGene FrequencyStart codonReference ValuesLeukocytesGeneticsmedicineHumansPoint MutationAmino Acid SequenceAge of OnsetCodonTransversionGeneAllele frequencyBiological PsychiatryGenetics (clinical)DNA PrimersRepetitive Sequences Nucleic AcidSequence DeletionGeneticsMutationBase SequenceTransition (genetics)Receptors Dopamine D2Receptors Dopamine D4Genetic VariationDNAExonsMiddle Agedmedicine.diseasePsychiatry and Mental healthTransmembrane domainSchizophreniaSchizophreniaPanic DisorderPolymorphism Restriction Fragment Length
researchProduct

Effect of changing pulse rate on profile parameters of perceptual thresholds and loudness comfort levels and relation to ECAP thresholds in recipient…

2010

Abstract: The Nucleus CI24RE Freedom device offers higher stimulation rates and lower noise levels in action potential measurements (ECAPs) than previous devices. A study including ten European implant teams showed that the effect of changes in rate from 250 to 3500 pulses per second on tilt and curvature of the T and C profiles is insignificant. When changing rate one may change the levels at all electrodes by the same amount. Using an automated procedure ECAPs could be measured quickly and reliably at a noise level of only 1 μV. However, this did not result in improved correlations between the tilt and curvature parameters of the ECAP profiles and those of the T and C profiles. Average C …

AdultPulse repetition frequencyLinguistics and Languagemedicine.medical_specialty3616 Speech and HearingLoudness Perceptionmedia_common.quotation_subjectAction PotentialsDifferential Threshold610 Medicine & health10045 Clinic for OtorhinolaryngologyStimulus (physiology)AudiologyCurvatureLanguage and LinguisticsLoudnessAutomationYoung AdultSpeech and HearingPerceptionmedicineHumansComfort levels1203 Language and LinguisticsAgedmedia_commonMathematicsPrincipal Component AnalysisAuditory ThresholdMiddle AgedElectric Stimulation3310 Linguistics and LanguageCochlear Implantsmedicine.anatomical_structurePulse rateAuditory PerceptionHuman medicineNoiseNucleus
researchProduct

Speech perception performance as a function of stimulus pulse rate and processing strategy preference for the Cochlear™ Nucleus®CI24RE device: Relati…

2010

Current cochlear implants can operate at high pulse rates. The effect of increasing pulse rate on speech performance is not yet clear. Habituation to low rates may affect the outcome. This paper presents the results of three subsequent studies using different experimental paradigms, applying the Nucleus CI24RE device, and conducted by ten European implant teams. Pulse rate per channel varied from 500 to 3500 pulses per second with ACE and from 1200 to 3500 pps with CIS strategy. The results showed that the first rate presented had little effect on the finally preferred rate. Lower rates were preferred. The effect of pulse rate on word scores of post-linguistic implantees was small; high rat…

AdultPulse repetition frequencyLinguistics and Languagemedicine.medical_specialtySpeech perceptionAdolescentHearing Loss SensorineuralLoudness Perceptionmedicine.medical_treatmentmedia_common.quotation_subjectAudiologyProsthesis DesignAffect (psychology)Severity of Illness IndexLanguage and LinguisticsCochlear nucleusLoudnessYoung AdultSpeech and HearingProsthesis FittingCochlear implantPerceptionmedicineHumansCorrection of Hearing ImpairmentHabituationAgedmedia_commonAged 80 and overAuditory ThresholdSignal Processing Computer-AssistedMiddle AgedElectric StimulationEuropeCochlear ImplantsPersons With Hearing ImpairmentsAcoustic StimulationAuditory PerceptionSpeech PerceptionAudiometry SpeechPsychologyInternational Journal of Audiology
researchProduct