Search results for " muscle"

showing 10 items of 1495 documents

Towards powerful old age : association between hormone replacement therapy and skeletal muscle

2010

estrogeenitnaisetrakenneagingcandidate geneKaksostutkimuslihaksethormone replacement therapyikääntyminengene expressionliikuntakykyhormonihoitoskeletal muscletwin studylihaskuntoikääntyneetestrogensmuscle weaknesslihasvoima
researchProduct

Single joint exercises do not provide benefits in performance and anthropometric changes in recreational bodybuilders

2020

The purpose of the present study was to compare the changes in anthropometric measures and muscle performance in users and non-users of androgenic anabolic steroids (AAS) performing resistance training (RT) programmes involving only multiple joint (MJ) exercises or a combination of MJ and single joint (SJ) exercises. Thirty recreational bodybuilders were divided into 4 groups: non-AAS users performing only MJ exercises (MJ), non-AAS users performing MJ + SJ (MJ + SJ), AAS users performing only MJ exercises (AAS − MJ) and AAS users performing MJ + SJ exercises (AAS − MJ + SJ). Before and after 8 weeks of training, the participants were tested for 10 repetition maximum (10RM) in different RT …

exercise selection muscle definition Muscle hypertrophy muscle strength resistance exerciseSettore M-EDF/01 - Metodi E Didattiche Delle Attivita' Motorie
researchProduct

The Association between Masticatory Muscles Activation and Foot Pressure Distribution in Older Female Adults: A Cross-Sectional Study

2023

The association between craniofacial muscles and postural control is well-known because of numerous anatomical connections. However, there are a few conflicting studies that correlated the activity of the masticatory muscles with the distribution of body weight pressure on the feet, which can strongly influence balance. Therefore, the purpose of our study was to evaluate the association between the masseter and temporalis muscle activity and foot pressure distribution. Fifty-two women were recruited, and baropodometric and EMG analyses of the masseter and temporalis baseline activities were analyzed. An ipsilateral association was found between the right temporal muscle activity and the rig…

exercise therapyneurologyHealth Toxicology and Mutagenesisagingexercise therapy; postural balance; dental occlusion; muscles; surface electromyography; aging; neurologyPublic Health Environmental and Occupational Healthdental occlusionmusclessurface electromyographypostural balanceInternational Journal of Environmental Research and Public Health
researchProduct

Aged Nicotinamide Riboside Kinase 2 Deficient Mice Present an Altered Response to Endurance Exercise Training

2018

Background: Skeletal muscle aging is marked by the development of a sarcopenic phenotype, a global decline of muscle energetic capacities, and an intolerance to exercise. Among the metabolic disorders involved in this syndrome, NAD metabolism was shown to be altered in skeletalmuscle, with an important role for the NAMPT enzyme recycling the nicotinamide precursor. An alternative pathway for NAD biosynthesis has been described for the nicotinamide riboside vitamin B3 precursor used by the NMRK kinases, including the striated muscle-specific NMRK2.Aim: With this study, our goal is to explore the ability of 16-month-old Nmrk2−/− mice to perform endurance exercise and study the consequences on…

exerciselcsh:QP1-981agingheartskeletal muscleNADNMRK2lcsh:PhysiologyFrontiers in Physiology
researchProduct

Vesiupotusmenetelmien vaikutus fyysisestä kuormituksesta palautumiseen miehillä

2017

Johdanto. Palautuminen on tärkeää erityisesti urheilijoiden harjoittelun ja kilpailujen yhteydessä. Sitä tapahtuu harjoituksen tai kilpailun aikana, välittömästi harjoituksen tai kilpailun jälkeen ja pitkäkestoisena harjoitusten ja kilpailujen välillä. Erilaisia palautumismenetelmiä on lukuisia ja niistä tärkeimpiä ovat aktiiviset menetelmät kuten kevyt aerobinen kuormitus sekä liikkuvuusharjoitukset. Passiivisia menetelmiä ovat uni, ravinto (nesteytys), hieronta, fysioterapia, painemenetelmät, lämpömenetelmät ja kylmäkäsittely. Tämän tutkimuksen tarkoitus oli selvittää aktiivisen palautumisen jälkeen suoritettujen eri vesiupotusmenetelmien sekä pelkän aktiivisen palautumisen vaikutusta fyy…

exercise-induced muscle damagevauriotfyysinen rasituspalautuminencold water immersionwater immersionsvesiupotusmenetelmätkontrastivesimenetelmärecoverythermoneutral water immersionphysical exercisecontrast water therapykylmävesimenetelmätermoneutraali vesiupotuskylpyhoitomiehetkylmähoitourheilusuorituksetlihassolut
researchProduct

Biomimetic strategy towards gelatin coatings on PET. Effect of protocol on coating stability and cell-interactive properties

2019

Gelatin-modified poly(ethylene terephthalate) (PET) surfaces have been previously realized via an intermediate dopamine coating procedure that resulted in surfaces with superior haemocompatibility compared to unfunctionalized PET. The present study addresses the biocompatibility assessment of these coated PET surfaces. In this context, the stability of the gelatin coating upon exposure to physiological conditions and its cell-interactive properties were investigated. The proposed gelatin–dopamine-PET surfaces showed an increased protein coating stability up to 24 days and promoted the attachment and spreading of both endothelial cells (ECs) and smooth muscle cells (SMCs). In parallel, physi…

food.ingredientBiocompatibilityCellBiomedical Engineering02 engineering and technologyengineering.material010402 general chemistry01 natural sciencesGelatinfoodCoatingSmooth muscleBiomimeticsmedicineGeneral Materials ScienceChemistryPolyethylene TerephthalatesGeneral ChemistryGeneral Medicine021001 nanoscience & nanotechnology0104 chemical sciencesPolyestermedicine.anatomical_structureengineeringSurface modificationGelatin0210 nano-technologyVascular graftBiomedical engineeringSURFACE MODIFICATION; CHEMISTRY; POLYESTER; ADHESION; FUNCTIONALIZATION; BIOCOMPATIBILITY; IMMOBILIZATION; PROLIFERATION; COMPATIBILITY; BIOMATERIALS
researchProduct

Exploration of muscle–tendon biomechanics one year after Achilles tendon rupture and the compensatory role of flexor hallucis longus

2023

Achilles tendon (AT) rupture leads to long-term structural and functional impairments. Currently, the predictors of good recovery after rupture are poorly known. Thus, we aimed to explore the interconnections between structural, mechanical, and neuromuscular parameters and their associations with factors that could explain good recovery in patients with non-surgically treated AT rupture. A total of 35 patients with unilateral rupture (6 females) participated in this study. Muscle-tendon structural, mechanical, and neuromuscular parameters were measured 1-year after rupture. Interconnections between the inter-limb differences (Δ) were explored using partial correlations, followed by multivar…

functionmuscleRehabilitationBiomedical EngineeringBiophysicslihaksetultrasonographyjänteetultraäänitutkimusOrthopedics and Sports Medicinemechanicalvammatbiomekaniikkakantajänneflexor hallucis longus muscletendons
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Teprotumumab reduces extraocular muscle and orbital fat volume in thyroid eye disease

2020

PurposeThyroid eye disease (TED) is a progressive, debilitating and potentially vision-threatening autoimmune disease. Teprotumumab, a novel human monoclonal antibody, has been shown to reverse the clinical manifestations of TED. Patients receiving teprotumumab have been shown in two multicenter, randomized placebo-controlled trials to have decreased proptosis, diplopia and inflammation after 24 weeks of treatment. This study aims to analyse volumetric and inflammatory changes on orbital imaging prior to and after teprotumumab treatment from one of these trials.DesignRetrospective review.SubjectsSix patients enrolled in the phase III teprotumumab clinical trial (OPTIC, NCT03298867) with act…

genetic structuresEye disease030209 endocrinology & metabolismAntibodies Monoclonal HumanizedExtraocular muscles03 medical and health sciencesCellular and Molecular Neuroscience0302 clinical medicineOrbital fatmedicineHumansInflammationAutoimmune diseaseDiplopiabusiness.industryTeprotumumabThyroidmedicine.diseaseeye diseasesSensory SystemsGraves OphthalmopathyOphthalmologymedicine.anatomical_structureOculomotor Muscles030221 ophthalmology & optometrysense organsmedicine.symptomNuclear medicinebusinessOrbitOrbit (anatomy)medicine.drugBritish Journal of Ophthalmology
researchProduct

The Internuclear Ophthalmoplegias

1993

Internuclear ophthalmoplegia (INO), which is caused by an ipsilateral medial longitudinal fasciculus (MLF) lesion, is characterized by adduction paresis of lateral gaze, usually with spared convergence [1–4]. In the opposite eye, abduction nystagmus and hypermetric abduction saccades are the main clinical and electro-oculographic abnormalities [1, 5, 6]. The origin of both is still debated. Abduction nystagmus has been explained by (a) an additional horizontal gaze paresis [7]; (b) vergence mechanisms aimed at alignment of the visual axes [8]; (c) interruption of descending excitatory projections from oculomotor nucleus internuclear neurons to contralateral abducens nucleus motoneurons [9];…

genetic structuresbusiness.industryMedial rectus muscleInternuclear ophthalmoplegiaParamedian pontine reticular formationAnatomyNystagmusmedicine.diseaseMedial longitudinal fasciculuseye diseasesOculomotor nucleusbody regionsmedicine.anatomical_structureAbducens nucleusmedicinesense organsmedicine.symptombusinessParesis
researchProduct