Search results for " view"

showing 10 items of 337 documents

The wide-field imager for IXO: status and future activities

2010

The Wide Field Imager (WFI) of the International X-ray Observatory (IXO) is an X-ray imaging spectrometer based on a large monolithic DePFET (Depleted P-channel Field Effect Transistor) Active Pixel Sensor. Filling an area of 10 x 10 cm2 with a format of 1024 x 1024 pixels it will cover a field of view of 18 arcmin. The pixel size of 100 x 100 μm2 corresponds to a fivefold oversampling of the telescope's expected 5 arcsec point spread function. The WFI's basic DePFET structure combines the functionalities of sensor and integrated amplifier with nearly Fano-limited energy resolution and high efficiency from 100 eV to 15 keV. The development of dedicated control and amplifier ASICs allows for…

X-ray AstronomyImaging spectrometerWide Field ImagerField of viewSettore ING-INF/01 - ElettronicaIntegrated amplifierlaw.inventionTelescopeOpticslawWFIDePFETX-ray SpectroscopyInternational X-ray Observatory; IXO; Wide Field Imager; WFI; X-ray Astronomy; X-ray Spectroscopy; X-ray Imaging; DePFET; Active Pixel SensorPhysicsCMOS sensorActive Pixel SensorsezelePixelSpectrometerbusiness.industryAmplifierIXOInternational X-ray ObservatorybusinessX-ray ImagingSpace Telescopes and Instrumentation 2010: Ultraviolet to Gamma Ray
researchProduct

ATHENA WFI optical blocking filters development status toward the end of the instrument phase-A

2018

Copyright 2018 Society of Photo-Optical Instrumentation Engineers (SPIE). One print or electronic copy may be made for personal use only. Systematic reproduction and distribution, duplication of any material in this paper for a fee or for commercial purposes, or modification of the content of the paper are prohibited. The Wide Field Imager (WFI) is one of the two instruments of the ATHENA astrophysics space mission approved by ESA as the second large mission in the Cosmic Vision 2015-2025 Science Programme. The WFI, based on a large array of depleted field effect transistors (DEPFET), will provide imaging in the 0.2-15 keV band over a 40'x40' field of view, simultaneously with spectrally an…

X-ray detectorCosmic VisionPhotonX-ray detectorWide Field ImagerField of viewCondensed Matter Physic7. Clean energy01 natural sciences010309 opticsX-ray astronomyOpticsSettore FIS/05 - Astronomia E Astrofisica0103 physical sciencesAthenaSpectral resolutionElectrical and Electronic EngineeringOptical blocking filter010303 astronomy & astrophysicsPhysicsCMOS sensorbusiness.industryElectronic Optical and Magnetic MaterialDetectorComputer Science Applications1707 Computer Vision and Pattern RecognitionPhoton countingApplied MathematicActive pixel sensor13. Climate actionbusinessDEPFET
researchProduct

The LOFT mission concept: a status update

2016

The Large Observatory For x-ray Timing (LOFT) is a mission concept which was proposed to ESA as M3 and M4 candidate in the framework of the Cosmic Vision 2015-2025 program. Thanks to the unprecedented combination of effective area and spectral resolution of its main instrument and the uniquely large field of view of its wide field monitor, LOFT will be able to study the behaviour of matter in extreme conditions such as the strong gravitational field in the innermost regions close to black holes and neutron stars and the supra-nuclear densities in the interiors of neutron stars. The science payload is based on a Large Area Detector (LAD, >8m2 effective area, 2-30 keV, 240 eV spectral resolut…

X-ray timing[ SDU.ASTR.GA ] Sciences of the Universe [physics]/Astrophysics [astro-ph]/Galactic Astrophysics [astro-ph.GA]Field of viewAstrophysics01 natural scienceslaw.inventionlawObservatorytiming010303 astronomy & astrophysicsQBPhysicsmicrochannel plates. PROPORTIONAL COUNTER ARRAYCALIBRATIONX-ray astronomyElectronic Optical and Magnetic MaterialApplied MathematicsAstrophysics::Instrumentation and Methods for AstrophysicsComputer Science Applications1707 Computer Vision and Pattern RecognitionX-ray detectorsCondensed Matter Physicscompact objectsX-ray spectroscopy[SDU.ASTR.GA]Sciences of the Universe [physics]/Astrophysics [astro-ph]/Galactic Astrophysics [astro-ph.GA]spectroscopyCosmic Vision[ INFO ] Computer Science [cs]Silicon detectorAstrophysics::High Energy Astrophysical PhenomenaCondensed Matter PhysicTelescopeX-rayX-ray astronomySilicon detectors; spectroscopy; timing; X-ray astronomy; Electronic Optical and Magnetic Materials; Condensed Matter Physics; Applied Mathematics; Electrical and Electronic EngineeringSettore FIS/05 - Astronomia e Astrofisica0103 physical sciencesElectronic[INFO]Computer Science [cs]Optical and Magnetic MaterialsSpectral resolutionElectrical and Electronic EngineeringDETECTORta115X-ray astronomy Silicon detectors timing spectroscopy010308 nuclear & particles physicsX-ray imagingX-ray timing; X-ray spectroscopy; X-ray imaging; compact objects; X-ray detectors; microchannel plates. PROPORTIONAL COUNTER ARRAY; CALIBRATION; DETECTORApplied MathematicNeutron starQB460-466 AstrophysicsSilicon detectors; spectroscopy; timing; X-ray astronomy; Electronic Optical and Magnetic Materials; Condensed Matter Physics; Computer Science Applications1707 Computer Vision and Pattern Recognition; Applied Mathematics; Electrical and Electronic EngineeringSilicon detectors; spectroscopy; timing; X-ray astronomySilicon detectorsLarge Observatory For x-ray Timing (LOFT) Large Area Detector (LAD) Wide Field Monitor (WFM) Large Area Silicon Drift Detectors (SDD)Gamma-ray burst
researchProduct

Amerikāņu un meksikāņu viedoklis par „amerikāņu sapni”

2017

Bakalaura darba tēma ir uzzināt Amerikāņu un Meksikāņu viedokļus par "Amerikāņu sapni", kuri atspoguļojas filmās, kā arī, to kā Amerikāņu sapnis ir uztverts filmās "Ziemeļi" (1984) un "Tiekšanās pēc laimes" (2006). Galvenais uzdevums bija analizēt filmas, lai redzētu kā Amerikāņu sapnis tiek panākts abām nācijām. Papildus, šim uzdevumam tika arī uzsvērti Amerikāņu sapņa elementi, kas raksturo šo fenomenu. Pētījumā viens no uzdevumiem bija atrast Amerikāņu sapnim pašu piemērotāko definīciju un elementus kas to veido. Tas tika paveikts lasot dažādu autoru grāmatas un rakstus, kuri diskutē par šo tēmu. Bakalaura darbā tika izmantotas pētīšanas metodes, tādas kā, bibliotēkas pētījumi un filmu, …

ZiemeļiPoints of viewValodniecībaThe Pursuit of HappynessAmerikāņi un meksikāņiThe American Dream
researchProduct

Evolutionary-based 3D reconstruction using an uncalibrated stereovision system: application of building a panoramic object view

2010

In this paper, we propose an original evolutionary-based method for 3D panoramic reconstruction from an uncalibrated stereovision system (USS). The USS is composed of five cameras located on an arc of a circle around the object to be analyzed. The main originality of this work concerns the process of the calculation of the 3D information. Actually, with our method, 3D coordinates are directly obtained without any prior estimation of the fundamental matrix. The method operates in two steps. Firstly, points of interest are detected in pairs of images acquired by two consecutive cameras of the USS are matched. And secondly, using evolutionary algorithms, we jointly compute the transformed matr…

[INFO.INFO-MM] Computer Science [cs]/Multimedia [cs.MM]Object viewComputer Networks and CommunicationsComputer sciencebusiness.industry3D reconstruction[INFO.INFO-MM]Computer Science [cs]/Multimedia [cs.MM]020207 software engineering02 engineering and technologyHardware and Architecture0202 electrical engineering electronic engineering information engineeringMedia Technology020201 artificial intelligence & image processingComputer visionArtificial intelligenceFundamental matrix (computer vision)businessSoftwareComputingMilieux_MISCELLANEOUS[ INFO.INFO-MM ] Computer Science [cs]/Multimedia [cs.MM]
researchProduct

Dacarbazine mediate antimelanoma effects via NK cells.

2013

International audience; Melanoma is a highly chemoresistant and metastatic tumor that, in the absence of BRAF mutations, is generally treated with the alkylating agent dacarbazine (DTIC). We discovered that DTIC upregulates the expression of NKG2D ligands on tumor cells, leading to the activation of natural killer (NK) and CD8(+) T cells. These observations underscore the immunogenic properties of DTIC and provide a rationale to combine DTIC with immunotherapeutic agents.

[SDV.IMM] Life Sciences [q-bio]/ImmunologyDacarbazineImmunologyNkg2d ligandsTumor cellschemical and pharmacologic phenomenadacarbazineNK cellsMetastatic tumorNKG2DmedicinemelanomaImmunology and Allergy[ SDV.IMM ] Life Sciences [q-bio]/ImmunologyB16Author's Viewbusiness.industryMelanomamedicine.diseaseNKG2D3. Good healthOncologyImmunologyCancer research[SDV.IMM]Life Sciences [q-bio]/ImmunologybusinessCD8medicine.drug
researchProduct

Du cadre littéraire de A Room with a View (E.M. Forster) à son décentrement cinématographique (James Ivory) : éléments de réflexion pour une esthétiq…

2010

International audience; Dans A Room with a View (1908), E. M. Forster multiplie les cadres topographiques afin d'opérer un « cadrage » de son intrigue et de son héroïne immédiatement signifiant. Par le motif de la fenêtre, les titres de chapitres, les commentaires du narrateur ou par la réification consécutive à la comparaison avec la peinture de Léonard de Vinci, le personnage de Lucy Honeychurch est à ce point encadré qu'il lui faut sortir de ces espaces textuels étouffants et revendiquer qu'il est surtout un corps vivant dans un espace mouvant. Une première dialectique entre ces trois termes souligne ainsi les ancrages principaux et les limites de l'écriture forstérienne, puisque la récu…

[SHS.LITT] Humanities and Social Sciences/LiteratureE. M. Forster[SHS.LITT]Humanities and Social Sciences/LiteratureJames Ivoryesthétique filmique[ SHS.LITT ] Humanities and Social Sciences/LiteratureA Room with a Viewbéance
researchProduct

An overview of the concepts of change and development - from the premodern to modern era

2012

This chapter focuses on the concepts of change and progress: on one hand, it approaches this topic from the point of view of the history of science; on the other hand, from the point of view of modern developmental psychology. The section on the history of science focuses on the historical period of the pre-modern Hellenistic era to the Enlightenment. This period is long, and it therefore includes several, different world views and cultural trends. In this chapter culturally significant trends of thought within the PtolemaicAristotelic tradition are described.The section on the modern developmental psychology approach analyses the following questions: (1) which characteristics must changes …

adulthoodPerspective (graphical)ajatteluIntellectual historyEpistemologyAge of EnlightenmentGeographyaikuisuusLearning theorythinkingGrand theoryHistory of sciencePeriod (music)World view
researchProduct

Henkilön psykiatria : psykiatrian dialektinen filosofia

2017

The Finnish word ’henkilö’ is difficult to translate in English as a ‘Person’, but in international plan-language, Esperanto, we can quite exactly translate it as ‘spiritulo’. The word henkilö, spiritulo, is developed in the 19th century from the ancient Finnish word ‘henki’ by the medical doctor in Jyväskylä region Wolmar Schildt-Kilpinen. He was not satisfied with the simple translation from Latin word ‘persona’ to Finnish ‘persoona’, and so via the ancient word he conceptually combined the spiritulo to the dialectical process of negation of negation of the ethnic culture – elite culture – national culture. So the spiritulo could express the community (Gemeinschaft) and common (gemein) at…

akuuttihoitopersonpsychiatric treatmentpsychiatric rehabilitationmaailmankuvapersoonaworld viewethicspsychiatrydialecticshenkilötpsykiatriapsykiatrinen hoitopsykiatrinen kuntoutusetiikkasubjectsubjekti (filosofia)dialektiikka
researchProduct

Alternative discourses in science fiction: human cloning in Glory Season (1993) by David Brin

2005

alternative viewhuman cloningkloonausscience fictiondiskurssigeenitekniikkadiscoursediscourse analysisBrin DavidGlory seasontieteiskirjallisuus
researchProduct