Search results for "ACID"

showing 10 items of 13107 documents

Fomentar la resiliencia en familias con enfermedades crónicas pediátricas

2013

En este artículo se describen los diferentes enfoques que se pueden aplicar al estudio del concepto de resiliencia familiar en el contexto de las enfermedades crónicas pediátricas y sus implicaciones en la práctica clínica y educativa. Asimismo, se describen los principios generales que deben regir esta práctica y las actuaciones concretas de los profesionales de los sistemas sanitarios, educativos y sociales. La resiliencia familiar es imprescindible para mantener una buena calidad de vida del niño enfermo y de la familia en su conjunto.

lcsh:Social SciencesEnfermosintervención psicoeducativaEnfermedades crónicasEnfoque multiprofesionallcsh:Social sciences (General)Efectosorientación familiarfamiliaPanorama internacionalNecesidadesServicios de apoyoenfermedad crónica pediátricaGeneral MedicineIntervenciónAdaptación personallcsh:HresilienciaImpacto familiarDiscapacidadRecomendacionesPlanificación de serviciosFamíliaFamiliaterapia familiarlcsh:H1-99InfanciaREVISTA ESPAÑOLA DE DISCAPACIDAD
researchProduct

Un programa de formación en lectura crítica en internet para jóvenes con discapacidad intelectual

2018

Delgado, P. et al. (2018): “Un programa de formación en lectura crítica en internet para jóvenes con discapacidad intelectual”. Revista Española de Discapacidad, 6 (II): 229-245.

lcsh:Social Scienceslcsh:Hdiscapacidad intelectual.lcsh:H1-99General Medicinealfabetización digitallcsh:Social sciences (General)programa de formaciónLectura críticaREVISTA ESPAÑOLA DE DISCAPACIDAD
researchProduct

El rol de las familias españolas con hijos con discapacidad en la inclusión educativa. Una mirada histórico-normativa

2016

García-García, F. J. y López-Torrijo, M. (2016): “El rol de las familias españolas con hijos con discapacidad en la inclusión educativa. Una mirada histórico-normativa”. Revista Española de Discapacidad, 4 (2): 219-233.

lcsh:Social Scienceslcsh:Hinclusión socialfamiliaEducación inclusiva inclusión social familia discapacidad participación formación.discapacidadlcsh:H1-99General Medicinelcsh:Social sciences (General)participaciónformación.Educación inclusivaRevista Española de Discapacidad
researchProduct

Green approach to corrosion inhibition of stainless steel in phosphoric acid of Artemesia herba albamedium using plant extract

2019

Essential oil from aerial parts of Artemisia herba-alba from Morocco was hydrodistilled and its chemical composition oil was investigated by capillary GC and GC/MS. The major components were 1,8-cineole (35.6%) and camphor (24.1%). Artemisia herba-alba essential oil AHAO was tested as corrosion inhibitor of stainless steel (SS) in 1M H3PO4 using potentiodynamic polarization (PDP) and electrochemical impedance spectroscopy measurements (EIS) and scanning electronically microscopy (SEM) studies. The results obtained showed that the essential oil of Artemisia reduces the corrosion rate. Tafel polarization method indicates that the plant extract behaves as a mixed type inhibitor. The inhibition…

lcsh:TN1-997Materials science02 engineering and technology01 natural sciencesEssential oilINGENIERIA QUIMICAAbsorciólaw.inventionCorrosionBiomaterialssymbols.namesakechemistry.chemical_compoundCorrosion inhibitorAdsorptionlaw0103 physical sciencesPhosphoric acidEssential oillcsh:Mining engineering. MetallurgyInhibition010302 applied physicsTafel equationArtemisia herba-albaMetals and AlloysLangmuir adsorption model021001 nanoscience & nanotechnologyStainless SteelSurfaces Coatings and FilmsDielectric spectroscopyCorrosionchemistryCeramics and CompositessymbolsAdsorptionAcer Corrosió0210 nano-technologyNuclear chemistry
researchProduct

Structural characterization and optical constants of p-toluene sulfonic acid doped polyaniline and its composites of chitosan and reduced graphene-ox…

2020

Para-Toluene sulfonic acid doped polyaniline (PANI), PANI/chitosan composites, PANI/reduced graphene-oxide composites and a ternary composite comprising of PANI, chitosan and reduced graphene-oxide have synthesised via oxidative polymerisation of aniline by Ammonium peroxydisulfate (APS). FTIR, XRD, FESEM and UV-VIS techniques were performed for the confirmation of the successful synthesis. The fundamental optical parameters such as, complex refractive index, complex dielectric constants and optical conductivity of the PANI and the composites were investigated in the UV-VIS-NIR range. The results show a clear dependence on the constituent component such as sulphur as well as the absorbance …

lcsh:TN1-997SystemMaterials scienceReduced graphene-oxideOxideNanofibersOptical conductivity02 engineering and technologySulfonic acid01 natural sciencesOptical conductivitylaw.invention[SPI.MAT]Engineering Sciences [physics]/MaterialsBiomaterialsAbsorbancechemistry.chemical_compoundFabricationAnilinelawOptical constant0103 physical sciencesFourier transform infrared spectroscopyComposite materialPolymerlcsh:Mining engineering. Metallurgy010302 applied physicschemistry.chemical_classificationChitosanGrapheneMetals and AlloysPolymerTernary compositeDispersion021001 nanoscience & nanotechnologySurfaces Coatings and FilmschemistryCeramics and Composites[PHYS.COND.CM-MS]Physics [physics]/Condensed Matter [cond-mat]/Materials Science [cond-mat.mtrl-sci]0210 nano-technologyp-Toluene sulfonic acid doped polyanilineRemoval
researchProduct

Leaching characteristics of Sc-enriched, Fe-depleted acidic slags

2022

Scandium is currently classified as a critical raw material for the European Union, and several research projects focus on the search for new sources to supply to its expected increasing demand. The Kiviniemi mafic intrusion in Finland is a potential primary source for Sc; at Kiviniemi, Sc occurs mainly within the lattices of ferrous silicates, clinopyroxene and amphibole. Some of the main challenges in leaching of Kiviniemi-type feed material are related to either the complexity of Fe and Ti separation from Sc-containing solutions or a possible gelation problem when leaching a material with a high SiO2 content. According to preliminary beneficiation tests, direct acid leaching of the Kivin…

leachingrikkihappoControl and Systems EngineeringMechanical Engineeringsulfuric acidvetyperoksidihuuhtoutuminenscandiumhydrogen peroxideGeneral ChemistryGeotechnical Engineering and Engineering Geologyacidic slagskandium
researchProduct

Growth and Electrochemical Performance of Lead and Lead Oxide Nanowire Arrays as Electrodes for Lead-Acid Batteries

2013

n this work, we present the growth and electrochemical performance of nanostructured lead and lead oxide electrodes for lead-acid batteries. The electrodes were obtained by template electrodeposition in polycarbonate membranes, acting as template. Electrochemical tests were conducted at constant current in 5M aqueous solution of sulphuric acid, after assembling nanostructured lead and lead oxide electrodes in a zero-gap configuration using a commercially available separator. The main advantages of these electrodes are the high specific energy and power density, and the wide surface area, about 70 times higher than the geometrical one. These features allowed high discharge rates, up to 20C. …

lead lead oxide nanostructures lead acid batteries electrodepositionSettore ING-IND/23 - Chimica Fisica Applicatalcsh:Computer engineering. Computer hardwareNanostructures Lead Lead oxide Electrodeposition Template Synthesis Lead acid batterylcsh:TP155-156lcsh:TK7885-7895lcsh:Chemical engineeringChemical Engineering Transactions
researchProduct

Spectroscopic and Structural Investigation of the Confinement of D and L Dimethyl Tartrate in Lecithin Reverse Micelles

2009

The confinement of D and L dimethyl tartrate in lecithin reverse micelles dispersed in cyclohexane has been investigated by FT-IR, polarimetry, electronic and vibrational circular dichroism (ECD and VCD), 1H NMR, and small-angle X-ray scattering (SAXS). Measurements have been performed at room temperature as a function of the solubilizate-to-surfactant molar ratio (R) at fixed lecithin concentration. The analysis of experimental data indicates that the dimethyl tartrate molecules are solubilized within reverse micelles in proximity to the surfactant head groups in the same way for the D and L forms. The encapsulation of dimethyl tatrate within lecithin reverse micelles involves changes in i…

lecithin dimethyl tartrate FT-IR polarimetry circular dichroism NMR SAXSfood.ingredientCyclohexanemicellesTartrateLecithinMicellePolyethylene Glycolschemistry.chemical_compoundfoodLecithinsMaterials ChemistryOrganic chemistryPhysical and Theoretical ChemistryTartratesModels StatisticalDose-Response Relationship DrugChemistry PhysicalViscosityChemistrySmall-angle X-ray scatteringTemperaturetechnology industry and agricultureElasticitySurfaces Coatings and FilmslecithinModels ChemicalSpectrophotometryVibrational circular dichroismMicellar solutionsPhosphatidylcholinesProton NMRPhysical chemistrylipids (amino acids peptides and proteins)Rheologydimethyl tartrate
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Capacidades dinámicas de las PYME en el mercado de las licitaciones públicas internacionales

2017

Tesis Doctoral: “Capacidades dinámicas de las PYME en el mercado de las licitaciones públicas Internacionales” - Juan Manuel García García La tesis doctoral trata de las capacidades dinámicas que deben tener y desarrollar las PYME para mantener y desarrollar su actividad en entornos dinámicos y complejos en el contexto del mercado de las licitaciones públicas internacionales. En concreto, se busca determinar las barreras que perciben las PYME al abordar el mercado de las licitaciones públicas internacionales y cómo las capacidades dinámicas genéricas y específicas que tiene y que puede generar la empresa permiten superar dichas barreras. El mercado de las licitaciones públicas es un mercado…

licitación internacionalUNESCO::CIENCIAS ECONÓMICAS::Organización y dirección de empresas ::Organización de recursos humanosorganismos internacionalesconcursos internacionaleslicitaciones públicasUNESCO::CIENCIAS ECONÓMICAS::Economía internacional::Operaciones comerciales internacionales:CIENCIAS ECONÓMICAS::Economía internacional::Operaciones comerciales internacionales [UNESCO]:CIENCIAS ECONÓMICAS::Organización y dirección de empresas ::Organización de recursos humanos [UNESCO]capacidades dinámicasconcurso internacionalinternacionalizaciónlicitaciones públicas internacionalescapacidades dinámicas internacionalizaciónlicitaciones internacionalescontratación pública internacionalorganismos multilaterales
researchProduct