Search results for "ADD"

showing 10 items of 3360 documents

Late Activation of Stress-activated Protein Kinases/c-Jun N-terminal Kinases Triggered by Cisplatin-induced DNA Damage in Repair-defective Cells

2011

Although stress-activated protein kinases/c-Jun N-terminal kinases (SAPK/JNK) are rapidly activated by genotoxins, the role of DNA damage in this response is not well defined. Here we show that the SEK1/MKK4-mediated dual phosphorylation of SAPK/JNK (Thr-183/Tyr-185) correlates with the level of cisplatin-DNA adducts at late times (16–24 h) after drug treatment in both human and mouse cells. Transfection of platinated plasmid DNA also caused SAPK/JNK activation. A defect in transcription-coupled nucleotide excision repair resting on a mutation in Cockayne syndrome group B protein promoted the late SAPK/JNK activation following cisplatin exposure. Signaling to SAPK/JNK was accompanied by act…

rho GTP-Binding ProteinsDNA RepairMAP Kinase Kinase 4DNA repairDNA damageDNA damage response; DNA repair; cisplatin-DNA adducts; SAPK/JNKp38 mitogen-activated protein kinasesAntineoplastic AgentsCell Cycle ProteinsAtaxia Telangiectasia Mutated ProteinsProtein Serine-Threonine KinasesDNA and ChromosomesBiologyBiochemistryAtaxia Telangiectasia Mutated ProteinsDNA AdductsMiceRadiation IonizingAnimalsHumansDNA Breaks Double-StrandedMolecular BiologyReplication protein ACells CulturedMice KnockoutKinaseTumor Suppressor ProteinsJNK Mitogen-Activated Protein KinasesCell BiologyMolecular biologyDNA-Binding ProteinsEnzyme Activationc-Jun N-terminal kinasesbiology.proteinCisplatinSignal TransductionNucleotide excision repairJournal of Biological Chemistry
researchProduct

Phenomenological Strands for Gaming Disorder and Esports Play: A Qualitative Registered Report

2021

The recent inclusion of gaming disorder in the ICD-11 as a mental disorder has further increased the importance of researching the health spectrum related to gaming. A critical area in this regard is the lack of clarity concerning the differences between gaming disorder and intensive play, the latter of which often involves several gaming hours per day without related health problems. In this study, we approached the above question by interpretive phenomenological analysis with interviews in two groups of highly involved videogame players: those who seek or have sought clinical help for their problems with gaming (n=6), and those who play esports more than 4 hours per day without self-repor…

riippuvuusvideopelitfenomenologiaongelmapelaaminenterveysaddiktiivisuuspsykopatologia
researchProduct

Uzależnienie od hazardu jako przyczyna rozwodu

2017

Niniejszy artykuł ma na celu zaprezentowane wpływu jaki może mieć uzależnienie od hazardu na życie rodzinne osoby cierpiącej na to zaburzenie. Podstawowym problemem badawczym jest ustalenie, czy uzależnienie od hazardu może być przyczyną rozwodu a w dalszej części odpowiedzi na pytanie czy hazard może być przyczyną rozpadu pożycia małżeńskiego stron. Omówienie tego zagadnienia wymaga ustalenia tego, co to jest uzależnienie od hazardu i jaki ma wpływ na rozpad więzi łączących małżonków przez pryzmat ich wzajemnych obowiązków oraz odpowiedzi na zasadnicze pytanie dotyczące orzeczenia rozwodu z winy małżonka z tego powodu

rozwódobowiązki małżeńskiefamilyuzależnienie od hazarduguilty breakdownthe obligations of mariagewina rozkładu pożyciarodzinadivorceaddiction to gamblingKultura bezpieczeństwa. Nauka - Praktyka - Refleksje
researchProduct

An International Survey of Quality and Safety Programs in Radiology

2021

Purpose: The aim of this study was to determine the status of radiology quality improvement programs in a variety of selected nations worldwide. Methods: A survey was developed by select members of the International Economics Committee of the American College of Radiology on quality programs and was distributed to committee members. Members responded on behalf of their country. The 51-question survey asked about 12 different quality initiatives which were grouped into 4 themes: departments, users, equipment, and outcomes. Respondents reported whether a designated type of quality initiative was used in their country and answered subsequent questions further characterizing it. Results: The re…

safetymedicine.medical_specialtyCanadaQuality managementAsiaInternationalitymedia_common.quotation_subjectquality improvementinternational surveymedicineHumansRadiology Nuclear Medicine and imagingQuality (business)value-addedSocieties Medicalmedia_commonQuality of Health Carebusiness.industryInternational surveyAustraliaGeneral MedicineglobalUnited StatesVariety (cybernetics)Europepeer-reviewHealth Care SurveysRadiologybusinessRadiologyProgram Evaluation
researchProduct

The pblm package: semiparametric regression for bivariate categorical responses in R

2014

We present an R package to fit semiparametric regression models for two categorical responses. It works for both nominal and ordered responses and several types of logits can be specified. Proportional, non-proportional and partial proportional odds models can be fitted, with marginal and association parameters estimated in a parametric or semiparametric way, via penalized maximum likelihood estimation. An application to show the potential of the package is carried out on a data set of Italian university students.

semiparametrically structured ordered modelpartial proportional-odds modelbivariate additive Dale modelstudents' performance
researchProduct

The Impact of Adolescent Internet Addiction on Sexual Online Victimization: The Mediating Effects of Sexting and Body Self-Esteem

2021

Adolescents’ problematic use of the internet and the risk of sexual online victimization are an increasing concern among families, researchers, professionals and society. This study aimed to analyze the interplay between adolescents’ addiction to social networks and internet, body self-esteem and sexual–erotic risk behavior online: sexting, sextortion and grooming. While sexting refers to the voluntary engagement in texting sexual–erotic messages, sextortion and grooming are means of sexual–erotic victimization through the use of the internet. Participants were 1763 adolescents (51% girls), aged 12 to 16 years (M = 14.56

sextingAdolescentHealth Toxicology and Mutagenesismedia_common.quotation_subjectSexual Behavioreducation050109 social psychologybody self-esteemArticleStructural equation modelingCyberbullyingDevelopmental psychologyAnimalsHumans0501 psychology and cognitive sciencesSocial mediaAssociation (psychology)ChildCrime Victimsmedia_commongroomingInternetGeekbusiness.industryAddiction05 social sciencesRPublic Health Environmental and Occupational HealthSelf-esteemMental healthstructural equation modeling (SEM)humanitiesinternet addictionsextortionAdolescent BehaviorSpainbehavior and behavior mechanismsMedicineThe InternetFemalebusinessPsychologyInternet Addiction Disorder050104 developmental & child psychology
researchProduct

Dual action of phosphonate herbicides in plants affected by herbivore—Model study on black bean aphid Aphis fabae rearing on broad bean Vicia faba pl…

2008

Abstract The interactions between plants, herbicides and herbivore insects were studied as an aspect of possible side effect of the using of phosphonate herbicides. The experimental system was composed of phosphonate herbicides, broad bean Vicia faba (L.) plants and black bean aphid Aphis fabae (Scopoli). Two means of herbicide application, namely standard spraying and direct introduction of the herbicide into stem via glass capillary, were examined. The results obtained for N-2-piridylaminomethylene bisphosphonic acid and its derivatives show 10 times higher inhibition of the plant growth if glass capillary mode was used. When plants were infested by aphids 24 h after the use of herbicide,…

side effectHealth Toxicology and MutagenesisOrganophosphonatesHost-Parasite Interactionschemistry.chemical_compoundAnimalsAphis fabaeHerbivorebiologyHerbicidesbusiness.industryfungiPublic Health Environmental and Occupational HealthPest controlfood and beveragesGeneral Medicinephosphonate herbicidesbiology.organism_classificationPollutionPhosphonateVicia fabaVicia fabaAphischemistryOlfactometerAgronomyAphidsGlyphosateBlack bean aphidadditive actionbusinessEcotoxicology and Environmental Safety
researchProduct

La sindrome del compartimento addominale (ACS) dopo chirurgia degli aneurismi dell'aorta addominale (AAA)

2008

sindrome del compartimento addominale aneurismi dell'aorta addominale
researchProduct

Evaluating Gender Differences in Problematic Smartphone Use

2022

Abstract. The Smartphone Addiction Inventory (SPAI) is widely used to measure problematic smartphone use (PSU). Although the SPAI has been translated and validated in different countries, its measurement invariance across gender has received little research attention. This study aimed to examine whether men and women interpreted the Italian version of the SPAI (SPAI-I) similarly and, consequently, whether the observed gender differences in SPAI scores, which have been shown in previous studies, could be due to true differences, rather than to differences in measurement. Six hundred nineteen Italian young adults ( Mage = 22.02 ± 2.63; 55.7% women) took part in the study and completed the SP…

smartphone addictionmeasurement invariancegender differencesdifferential item functioningApplied Psychologybehavioral addictionEuropean Journal of Psychological Assessment
researchProduct

Meaningful life and survival in urban poverty : an ethnographic study on the dimensions of deprivation and anxiety and the coping strategies of a gro…

2014

Tähän etnografiseen tutkimukseen on haastateltu seitsemää pitopalveluosuuskunnan jäsentä Addis Abebassa, Etiopiassa. Tutkimuksessa tarkastellaan haastateltavien pääasiallisia puutteen ja huolen aiheita, ja heidän henkilökohtaisia selviytymisstrategioitaan urbaanissa köyhyydessä. Kuinka ihmiset määrittelevät ja kokevat erilaiset päivittäiset puutteen ja huolen aiheensa? Mitä voimavaroja haastateltavat voivat käyttää selviytyäkseen urbaanissa köyhyydessä? Olen kytkenyt haastateltavien narratiivit Etiopiassa ja Addis Abebassa parhaillaan käynnissä olevaan yhteiskunnalliseen muutokseen hyödyntäen sekä haastatteluaineistoa että kirjallisuutta liittyen muun muassa urbaanin köyhyyden diskurssin ke…

social networksnaisetköyhtyminenkaupungitEtiopiaselviytyminenasuminenanxietycoping strategieselinkeinotlivelihoods developmenturban povertydeprivationpoverty alleviationsosiaaliset verkostotsurvival strategiesAddis Ababawomencooperative entrepreneurshiposuustoimintahousingköyhyys
researchProduct