Search results for "ADR"

showing 10 items of 6304 documents

Waiting for Fatima to become Sophie

2018

L’analyse se focalise sur l’« attente », comme temps de la narration du roman Al-kāfira de ‘Alī Badr et moyen de dénonciation de la mentalité misogyne imposée par les mutašaddidīn musallaḥīn qui contrôlent le village où Fāṭima-Sophie a passé son enfance et son adolescence. Dans ce climat de répression politique et d’oppression sociale, la représentation littéraire de l’attente devient métaphore d’une condition existentielle et d’une identité à la fois individuelle et collective.

'Ali BadrIraqi novelSettore L-OR/12 - Lingua E Letteratura ArabaArabic literature
researchProduct

Permanent magnet system to guide superparamagnetic particles

2017

A new concept of permanent magnet systems for guiding superparamagnetic particles on arbitrary trajectories is proposed. The basic concept is to use one magnet system with a strong and homogeneous (dipolar) magnetic field to magnetize and orient the particles. A second constantly graded field (quadrupolar) is superimposed to the first to generate a force. In this configuration the motion of the particles is driven solely by the component of the gradient field which is parallel to the direction of the homogeneous field. Then the particles are guided with constant force in a single direction over the entire volume. The direction can be adjusted by varying the angle between quadrupole and dipo…

010302 applied physicsPhysicsMagnetic momentCondensed matter physicsFOS: Physical sciences02 engineering and technologyMechanics021001 nanoscience & nanotechnologyCondensed Matter PhysicsPolarization (waves)Physics - Medical Physics01 natural sciencesElectronic Optical and Magnetic MaterialsMagnetic fieldDipoleMagnet0103 physical sciencesQuadrupoleVector fieldMedical Physics (physics.med-ph)0210 nano-technologyQuadrupole magnetJournal of Magnetism and Magnetic Materials
researchProduct

H− extraction systems for CERN’s Linac4 H− ion source

2018

Abstract Linac4 is a 160 MeV linear H −  accelerator at CERN. It is an essential part of the beam luminosity upgrade of the Large Hadron Collider (LHC) and will be the primary injector into the chain of circular accelerators. It aims at increasing the beam brightness by a factor of 2, when compared to the currently used 50 MeV linear proton accelerator, Linac2. Linac4’s ion source is a cesiated RF-plasma H −  ion source. Several beam extraction systems were designed for H −  beams of 45 keV energy, 50 mA intensity and an electron to H −  ratio smaller than 5. The goal was to extract a beam with an rms-emittance of 0 . 25 π  mm mrad. One of the main challenges in designing an H −  extraction…

010302 applied physicsPhysicsNuclear and High Energy PhysicsLarge Hadron ColliderParticle acceleratorElectron01 natural sciencesIon sourceLinear particle accelerator010305 fluids & plasmasIonlaw.inventionNuclear physicslaw0103 physical sciencesPhysics::Accelerator PhysicsThermal emittanceInstrumentationBeam (structure)Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Optical quantum information processing and storage

2018

Here we report our recent experimental progresses in optical quantum information processing. In particular, the following topics are included. First, we extend the heralding scheme to multi-mode states and demonstrate heralded creation of qutrit states. Next, we demonstrate storage of single-photon states and synchronized release of them. Then, we demonstrate real-time acquisition of quadrature values of heralded states by making use of an exponentially rising shape of wave-packets. Finally, we demonstrate cluster states in an arbitrarily long chain in the longitudinal direction.

010309 opticsQuantum opticsPhysics0103 physical sciencesStatistical physicsQuantum entanglementQutrit010306 general physicsQuantum information processing01 natural sciencesLong chainQuadrature (astronomy)Longitudinal directionQuantum Communications and Quantum Imaging XVI
researchProduct

Self-assembled Pt2L2 boxes strongly bind G-quadruplex DNA and influence gene expression in cancer cells

2017

Supramolecular Pt(ii) quadrangular boxes bind native and G-quadruplex DNA motifs in a size-dependent fashion. Three Pt molecular squares of distinct size show biological activity against cancer cells and heavily influence the expression of genes known to form G-quadruplexes in their promoter regions. The smallest Pt-box displays less activity but more selectivity for a quadruplex formed in the c-Kit gene.

010405 organic chemistryChemistrySupramolecular chemistryBiological activity010402 general chemistryG-quadruplex01 natural sciencesMolecular biology0104 chemical sciencesSelf assembledCell biologyInorganic Chemistrychemistry.chemical_compoundG-quadruplex PlatinumSettore CHIM/03 - Chimica Generale E InorganicaGene expressionCancer cellheterocyclic compoundsGeneDNADalton Transactions
researchProduct

Analysis of psychoactive substances in water by information dependent acquisition on a hybrid quadrupole time-of-flight mass spectrometer.

2016

Emerging drugs of abuse, belonging to many different chemical classes, are attracting users with promises of “legal” highs and easy access via internet. Prevalence of their consumption and abuse through wastewater-based epidemiology can only be realized if a suitable analytical screening procedure exists to detect and quantify them in water. Solid-phase extraction and ultra-high performance liquid chromatography quadrupole time-of-flight-mass spectrometry (UHPLC–QqTOF–MS/MS) was applied for rapid suspect screening as well as for the quantitative determination of 42 illicit drugs and metabolites in water. Using this platform, we were able to identify amphetamines, tryptamines, piperazines, p…

010501 environmental sciencesWastewaterMass spectrometryTandem mass spectrometry01 natural sciencesBiochemistryRiver waterHigh resolution mass spectrometryAnalytical ChemistryRiversTandem Mass SpectrometryQuantificationPsychoactive drugsHumansSample preparationSolid phase extractionQuadrupole time of flightChromatography High Pressure Liquid0105 earth and related environmental sciencesPsychotropic DrugsChromatographyChemistryIllicit Drugs010401 analytical chemistryOrganic ChemistrySolid Phase ExtractionWaterGeneral MedicineQuantitative determination0104 chemical sciencesWastewaterEnvironmental chemistryScreeningDatabases ChemicalWater Pollutants ChemicalJournal of chromatography. A
researchProduct

XMM-Newton observation of the supernova remnant Kes 78 (G32.8-0.1): Evidence for shock-cloud interaction

2017

The Galactic supernova remnant Kes 78 is surrounded by dense molecular clouds, whose projected position overlaps with the extended HESS gamma-ray source HESS J1852-000. The X-ray emission from the remnant has been recently revealed by Suzaku observations, which have shown indications for a hard X-ray component in the spectra, possibly associated with synchrotron radiation. We aim at describing the spatial distribution of the physical properties of the X-ray emitting plasma and at revealing the effects of the interaction of the remnant with the inhomogeneous ambient medium. We also aim at investigating the origin of the gamma-ray emission, which may be Inverse Compton radiation associated wi…

010504 meteorology & atmospheric sciencesAstrophysics::High Energy Astrophysical PhenomenaHadronSynchrotron radiationFOS: Physical sciencesElectronAstrophysicsISM: individual objects: Kes 7801 natural sciencesSpectral linelaw.inventionlawISM: cloud0103 physical sciencesSupernova remnant010303 astronomy & astrophysicsISM: supernova remnantAstrophysics::Galaxy Astrophysics0105 earth and related environmental sciencesPhysicsHigh Energy Astrophysical Phenomena (astro-ph.HE)Molecular cloudAstronomy and AstrophysicsPlasmaAstronomy and AstrophysicAcceleration of particleSynchrotronX-rays: ISM13. Climate actionSpace and Planetary ScienceAstrophysics - High Energy Astrophysical Phenomena
researchProduct

Venerid bivalve Venus verrucosa as a high-resolution archive of seawater temperature in the Mediterranean Sea

2021

Abstract High-resolution stable isotope data (δ18O, δ13C) were used to study growth strategies of the bivalve Venus verrucosa collected from three sites of the eastern coast of the Adriatic Sea. The principal objectives of this study were to identify the main growing season and to evaluate the potential applicability of δ18Oshell values to reconstruct the seasonal temperature variability. Calcium carbonate for oxygen and carbon isotope analyses was obtained by drilling the outer shell layer. Temporal and spatial variations in temperature and salinity values at the study sites were simulated using the 3D numerical ocean model ROMS. Annual periodicity of growth patterns was confirmed by δ18Os…

010506 paleontologyδ13Cδ18OStable isotope ratioTemperature salinity diagramsPaleontologyGrowing season010502 geochemistry & geophysicsOceanography01 natural sciencesOceanographyMediterranean seaSeawater14. Life underwaterBayStable isotopes ; Paleotemperature ; Adriatic Sea ; Growth rateEcology Evolution Behavior and SystematicsGeology0105 earth and related environmental sciencesEarth-Surface ProcessesPalaeogeography, Palaeoclimatology, Palaeoecology
researchProduct

Exploring species-level taxonomy in the Cryptocephalus flavipes species complex (Coleoptera: Chrysomelidae)

2016

In insects, morphological species identification is often challenging. The discrimination of closely related species may be hampered when only subtle differences in phenotypic characters or a continuum in their variability are present. This is exemplified in the Cryptocephalus flavipes species complex (Coleoptera; Chrysomelidae) where, until now, the species have been discriminated only by the yellow pattern on frons, pronotum, and epipleurae. In the present study, the phylogeny of the C. flavipes species complex was resolved through a multi-locus sequence approach, and the inclusion in the group of the phenotypically similar Cryptocephalus quadripustulatus Gyllenhal, 1813 was evaluated. Su…

0106 biological sciences0301 basic medicineSpecies complexgeometric morphometricZoologyCryptocephalus quadripustulatus010603 evolutionary biology01 natural sciencesnew ISS rRNA PCR primers03 medical and health sciencesNew 18SrRNA PCR primerSpecies levelPhylogeneticsSpecies delimitationLeaf beetleDNA taxonomyEcology Evolution Behavior and SystematicsTaxonomybiologyBiodiversitybiology.organism_classificationCryptocephalus flavipes030104 developmental biologyTaxonspecies deliminationAnimal Science and ZoologyTaxonomy (biology)Leaf beetleZoological Journal of the Linnean Society
researchProduct