Search results for "AKE"

showing 10 items of 10819 documents

Irradiation effects in CaF2probed by Raman scattering

2016

The formation conditions and dynamics of Ca colloids and point defects that appear in irradiated single crystals of CaF2 were investigated by Raman spectroscopy. The intensity changes in the Raman spectra because of the presence of different concentrations of point defects and Ca colloids that emerged in CaF2 after irradiation with 2.2 GeV Au ions were used to study their distribution and stability under illumination with three laser wavelengths (473, 532 and 633 nm) at different output powers (2 to 200 mW). A damage saturation at a fluence of 6 × 1011 ion cm−2 was observed. The dependence of the spectral changes on the ion fluence can be described by a core/halo damage cross-section model.…

010302 applied physicsChemistryAnalytical chemistry02 engineering and technology021001 nanoscience & nanotechnologyLaser01 natural sciencesCrystallographic defectMolecular physicsFluencelaw.inventionIonsymbols.namesakeSwift heavy ionlaw0103 physical sciencessymbolsGeneral Materials ScienceIrradiation0210 nano-technologyRaman spectroscopySpectroscopyRaman scatteringJournal of Raman Spectroscopy
researchProduct

Analytical description of solid particles kinematics due to a fluid flow and application to the depiction of characteristic kinematics in cold sprayi…

2017

Abstract In several multiphase flow applications such as fluidization, thermal spraying, atomization manufacturing and so on, the Newton's law is widely enacted to formulate the particle/fluid kinematic interaction and then to compute particles kinematics. This paper provides analytical solutions of the Newton's law in its time-dependent formulation or simplified formulation, the latter being a reduction of the time dependent problem into a spatial description of the particle motion. It was found that the velocity solution is strictly similar in both cases so that the simplified formulation is viable. The W_ 1 branch of the Lambert's function yields the analytical particle residence time an…

010302 applied physicsChemistryGeneral Chemical EngineeringMultiphase flow02 engineering and technologyMechanicsKinematics021001 nanoscience & nanotechnologyResidence time (fluid dynamics)01 natural sciencessymbols.namesakeMach number0103 physical sciencesFluid dynamicssymbolsParticleParticle velocity0210 nano-technologyMagnetosphere particle motionPowder Technology
researchProduct

Amorphous ultra-wide bandgap ZnOx thin films deposited at cryogenic temperatures

2020

Crystalline wurtzite zinc oxide (w-ZnO) can be used as a wide band gap semiconductor for light emitting devices and for transparent or high temperature electronics. The use of amorphous zinc oxide (a-ZnO) can be an advantage in these applications. In this paper we report on X-ray amorphous a-ZnOx thin films (~500 nm) deposited at cryogenic temperatures by reactive magnetron sputtering. The substrates were cooled by a nitrogen flow through the copper substrate holder during the deposition. The films were characterized by X-ray diffraction (XRD), Raman, infrared, UV-Vis-NIR spectroscopies, and ellipsometry. The a-ZnOx films on glass and Ti substrates were obtained at the substrate holder temp…

010302 applied physicsCondensed Matter - Materials ScienceMaterials sciencebusiness.industryBand gapGeneral Physics and AstronomyMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciences02 engineering and technologySubstrate (electronics)021001 nanoscience & nanotechnology01 natural sciencesAmorphous solidsymbols.namesakeSputteringEllipsometry0103 physical sciencessymbolsOptoelectronicsFourier transform infrared spectroscopyThin film0210 nano-technologybusinessRaman spectroscopy
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

X-ray diffraction and Raman spectroscopy studies in Na1/2Bi1/2TiO3-SrTiO3-PbTiO3 solid solutions

2016

The long and short range orders in 0.4Na1/2Bi1/2TiO3-(0.6-x)SrTiO3-xPbTiO3 solid solutions were studied by x-ray diffraction and Raman spectroscopy. X-ray diffraction patterns for these composition...

010302 applied physicsDiffractionMaterials scienceAnalytical chemistry02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic Materialssymbols.namesakeNuclear magnetic resonance0103 physical sciencesX-ray crystallographysymbols0210 nano-technologyRaman spectroscopySolid solutionFerroelectrics
researchProduct

Intrinsic nanostructures on the (001) surface of strontium titanate at low temperatures

2020

Atomically smooth (001) surfaces of SrTiO3 cut from the high-quality single crystals at two different miscut angles 0.9 and 7.0 deg between the real flat surfaces and crystallographic planes (001) were analyzed by means of the reflection high energy electron diffraction (RHEED) method from the room down to liquid helium temperatures. The diffraction patterns typical of the RHEED geometry close to ideal for a small miscut angle and those exhibiting distinct features of the specific periodicity associated with regular steps, which form due to the larger miscut angle, are presented. The surface symmetry and energetics were shown to impose differences in lattice parameters in parallel to a surf…

010302 applied physicsDiffractionMaterials scienceNanostructureReflection high-energy electron diffractionPhysics and Astronomy (miscellaneous)Condensed matter physicsGeneral Physics and Astronomy01 natural sciencesCondensed Matter::Materials Sciencesymbols.namesakechemistry.chemical_compoundchemistryElectron diffractionLattice (order)0103 physical sciencessymbolsStrontium titanate010306 general physicsRaman spectroscopySingle crystalLow Temperature Physics
researchProduct

Radial composition of single InGaN nanowires: a combined study by EDX, Raman spectroscopy, and X-ray diffraction

2013

010302 applied physicsDiffractionMaterials scienceNanostructureScatteringNanowireAnalytical chemistry02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter PhysicsEpitaxy01 natural sciencessymbols.namesakeCrystallography0103 physical sciencesX-ray crystallographysymbolsGeneral Materials Science0210 nano-technologyRaman spectroscopyMolecular beam epitaxyphysica status solidi (RRL) - Rapid Research Letters
researchProduct

RBS and ERD cross-sections and optical model parameters for the analysis of lithium, boron and nickel

2000

Abstract Elastic scattering cross-sections for RBS analysis of nickel by 7 Li and 11 B ion backscattering near the Coulomb barrier have been determined. The lithium ion measurements were performed in the energy range of 8–15 MeV at the laboratory angles of 115° and 135°. For boron ions the energies between 14 and 24 MeV and scattering angles of 89°, 110° and 130° were used. For the analysis of lithium and boron by ERD the scattering cross-sections have been calculated by kinematically reversing the backscattering process. The calculated 58 Ni ion energies thus varied between 65 and 125 MeV for lithium and between 75 and 130 MeV for boron recoils. For the Li + Ni and B + Ni systems the thres…

010302 applied physicsElastic scatteringNuclear and High Energy PhysicsScatteringchemistry.chemical_elementCoulomb barrier02 engineering and technology021001 nanoscience & nanotechnology7. Clean energy01 natural sciencesIonNickelsymbols.namesakechemistry0103 physical sciencessymbolsLithiumRutherford scatteringAtomic physics0210 nano-technologyBoronInstrumentationNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Electron transport and the effect of current annealing in a two-point contacted hBN/graphene/hBN heterostructure device

2020

In this work, we fabricated a 2D van der Waals heterostructure device in an inert nitrogen atmosphere by means of a dry transfer technique in order to obtain a clean and largely impurity free stack of hexagonal boron nitride (hBN)-encapsulated few-layer graphene. The heterostructure was contacted from the top with gold leads on two sides, and the device’s properties including intrinsic charge carrier density, mobility, and contact resistance were studied as a function of temperature from 4 K to 270 K. We show that the contact resistance of the device mainly originates from the metal/graphene interface, which contributes a significant part to the total resistance. We demonstrate that current…

010302 applied physicsElectron mobilityMaterials scienceGraphenebusiness.industryAnnealing (metallurgy)Contact resistanceGeneral Physics and AstronomyHeterojunction02 engineering and technology021001 nanoscience & nanotechnology01 natural scienceslaw.inventionsymbols.namesakeImpuritylaw0103 physical sciencessymbolsOptoelectronicsDry transfervan der Waals force0210 nano-technologybusinessJournal of Applied Physics
researchProduct

Systematic and statistical uncertainties of the hilbert-transform based high-precision FID frequency extraction method.

2021

Abstract Pulsed nuclear magnetic resonance (NMR) is widely used in high-precision magnetic field measurements. The absolute value of the magnetic field is determined from the precession frequency of nuclear magnetic moments. The Hilbert transform is one of the methods that have been used to extract the phase function from the observed free induction decay (FID) signal and then its frequency. In this paper, a detailed implementation of a Hilbert-transform based FID frequency extraction method is described, and it is briefly compared with other commonly used frequency extraction methods. How artifacts and noise level in the FID signal affect the extracted phase function are derived analytical…

010302 applied physicsLarmor precessionPhysicsNuclear and High Energy PhysicsPhysics - Instrumentation and Detectors010308 nuclear & particles physicsNoise (signal processing)Covariance matrixMathematical analysisBiophysicsFOS: Physical sciencesAbsolute valueInstrumentation and Detectors (physics.ins-det)Condensed Matter Physics01 natural sciencesBiochemistrySignalFree induction decaysymbols.namesake0103 physical sciencessymbolsHilbert transformUncertainty analysisJournal of magnetic resonance (San Diego, Calif. : 1997)
researchProduct