Search results for "ALAT"

showing 10 items of 4241 documents

Johtajat toimialamurroksen keskiössä : suomalaisen finanssialan ylimmän johdon selontekoja johtajuudesta

2013

leadershipjohtaminenthe financial industryfinanssialatoimialattransformationtruststrateginen johtaminenmuutosmuutosjohtaminenvastuuluottamusSuomiresponsibilityjohtajuusjohtajat
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Die Superprolls aus Dunkeldeutschland : Die den Ostdeutschen gegebene Identitäten in Bezug auf die Bezeichnung Ossi

2017

Yksi vähemmistöihin suhtautumisen tyypillisistä piirteistä yhteiskunnassamme on se, että niiden edustajille annetaan erilaisia, usein stereotyyppisiä identiteettejä tiettyjen nimitysten kautta. Tällaisille nimityksille on näennäisestä leikillisyydestä huolimatta ominaista jokseenkin negatiivinen lataus, joka aiheuttaa useiden ihmisten mielessä ennakkoluuloihin perustuvia assosiaatioita kyseisen vähemmistön edustajista puhuttaessa. Tässä kandidaatintutkielmassa tutkitaan, millaisia identiteettejä entisille itäsaksalaisille luodaan nimityksen Ossi kautta. Sanan Ossi käytöstä tekee erityisen mielenkiintoista se, että kyseistä nimitystä käytetään itäsaksalaisista monissa yhteyksissä yhä edellee…

lempinimetnimittelyalatyylisaksan kieliitäsaksalaisetidentiteettidiskurssintutkimus
researchProduct

Chirurgia refrattiva della cataratta e lenti multifocali

2010

lenti multifocalichirurgia refrattivaSettore MED/30 - Malattie Apparato Visivocataratta
researchProduct

Lesioni traumatiche delle parti molli

2011

lesione delle parti molli lesioni tendinee lesione muscolariSettore MED/33 - Malattie Apparato Locomotore
researchProduct

Lesioni ostetriche della spalla

2011

lesioni ostetriche della spalla paralisi ostetricheSettore MED/33 - Malattie Apparato Locomotore
researchProduct

LICENZIAMENTO E COMPORTO NON SCADUTO

2019

Il saggio affronta la questione del licenziamento illegittimo in quanto intimato a causa della malattia a comporto non ancora scaduto, dopo la recentissima sentenza delle Sezioni Unite della Corte di Cassazione del 2018, e dei connessi rimedi dopo la l. n. 92/2012 e dopo il d.lgs., n. 23/2015

licenziamento illegittimo comporto malattiaSettore IUS/07 - Diritto Del Lavoro
researchProduct

Miguel Calatayud: aproximació a l'obra infantil il·lustrada

2015

Aquesta investigació proposa endinsar-se en un context delimitat com és la il·lustració infantil valenciana i, més concretament, en l'anàlisi de les obres infantils il·lustrades de l'artista gràfic Miguel Calatayud amb el propòsit de posar en valor creacions amb unes qualitats com les que presenten la resta de disciplines artístiques.

llibres infantils il·lustratsil·lustració infantilMiguel CalatayudArt
researchProduct

Assessment of microplastics and other contaminants in marine vertebrates from the Western Mediterranean Sea

2023

Mediterranean marine biodiversity is under threat by pollution. For this reason, the main objective of this thesis was to analyse the presence of pollutants of concern in Mediterranean marine species. These studies are located in the Valencian Community (Spain), where we find loggerhead turtles, striped dolphins, and jewel lanternfish. Hence, we: 1. Analysed pesticides, heavy metals and phthalates in tissues of loggerhead turtles. 2. Studied microdebris present in beaches that are sporadically used as nesting grounds by loggerhead turtles. 3. Analysed striped dolphins# exposure to microplastics. 4. Quantified jewel lanternfish exposure to microplastics and tested their role as bioindicators…

loggerhead turtlesphthalatesmicroplasticslanternfishUNESCO::CIENCIAS DE LA VIDAmetalsenvironmental healthpesticidesMediterraneanstriped dolphinsmarine pollution
researchProduct

Alkuperäinen aineisto julkaisulle: Differences in parasite community composition support ecological differentiation in a freshwater gadoid fish

2022

The data file contains original data from burbot (Lota lota), captured from two sampling depths, littoral and profundal, in Lake Konnevesi during the breeding season of the fish in 2019-2020. The other variables indicate total body length of the fish (mm), gender, and abundance of 9 metazoan parasite taxa observed in the fish. Column F indicates the mean coverage of cataracts caused by Diplostomum parasites found in the eye lenses (column E).

loisetfish diseasesparasiteskalatauditeye diseases
researchProduct