Search results for "Acute myocardial infarction"

showing 10 items of 66 documents

Role of gene polymorphisms IL 10 (-1082 G/A) and TNFa (-308G/A) in susceptibility to acute myocardial infarction in young man.

2011

gene polymorphisms IL10 (-1082 G/A) and TNF a (-308G/A)acute myocardial infarctionSettore MED/05 - Patologia Clinicayoung man.
researchProduct

IN-HOSPITAL COMPLICATIONS OF ACUTE MYOCARDIAL INFARCTION IN HYPERTENSIVE SUBJECTS

2005

BACKGROUND: Recent studies have shown a worse in-hospital outcome in hypertensive than in normotensive patients with acute myocardial infarction (AMI), which has been attributed to more frequent complications. The aim of this study was to investigate clinical patterns, risk factors, and in-hospital complications in hypertensive and normotensive patients with AMI. METHODS: Of 4994 consecutive patients with AMI admitted to the intensive care unit, hypertensive patients with first infarction (n = 915; mean age 68.8 +/- 11.4 years) and 915 gender- and age-matched normotensive subjects were retrospectively studied. RESULTS: In the univariate analysis, hypertensive subjects presented more frequen…

hypertension myocardial infaction compllicationsacute myocardial infarction
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Variations in plasma lipids and in the LDL peak particle size after acute myocardial infarction

2002

lipids LDL acute myocardial infarction
researchProduct

Comparison of frequency domain measures based on spectral decomposition for spontaneous baroreflex sensitivity assessment after Acute Myocardial Infa…

2021

Abstract The objective of this study is to present a new method to assess in the frequency domain the directed interactions between the spontaneous variability of systolic arterial pressure (SAP) and heart period (HP) from their linear model representation, and to apply it for studying the baroreflex control of arterial pressure in healthy physiological states and after acute myocardial infarction (AMI). The method is based on pole decomposition of the model transfer function and on the following evaluation of causal measures of coupling and gain from the poles associated to low frequency (0.04−0.15 Hz) oscillatory components. It is compared with traditional non-causal approaches for the sp…

medicine.medical_specialty0206 medical engineeringBiomedical EngineeringHealth Informatics02 engineering and technologyAcute myocardial infarctionBaroreflexSettore ING-INF/01 - ElettronicaMatrix decomposition03 medical and health sciences0302 clinical medicineInternal medicinemedicineSpectral analysiscardiovascular diseasesMyocardial infarctionSensitivity (control systems)Spectral decompositionbusiness.industryHead-up tiltLinear modelBaroreflexmedicine.disease020601 biomedical engineeringFrequency domainCausalityBlood pressureFrequency domainCardiovascular controlSignal ProcessingSettore ING-INF/06 - Bioingegneria Elettronica E InformaticaCardiologybusiness030217 neurology & neurosurgery
researchProduct

Assessment of no-reflow phenomenon by myocardial blush grade and pulsed wave tissue doppler imaging in patients with acute coronary syndrome

2014

Background: No-reflow phenomenon is a complication of myocardial revascularization and it is associated with a worse prognosis. Materials and Methods: A prospective study was carried out enrolling patients with acute myocardial infarction (64 patients, 49 male and 15 female, median age 64.9 ± 10.61 years), both STEMI and NSTEMI, who underwent myocardial revascularization with percutaneous coronary intervention (PCI). TIMI flow and Myocardial Blush Grade (MBG) were assessed at baseline (T0), in addition to tissue Doppler imaging (TDI) and electrocardiogram. Cardiological evaluation was also performed at T1 (one month after PCI) and T2 (every year after revascularization for a mean follow-up …

medicine.medical_specialtyAcute coronary syndromemyocardial blush gradebusiness.industrymedicine.medical_treatmentDiastolePercutaneous coronary interventionAcute myocardial infarctionRevascularizationmedicine.diseaseInternal medicineConventional PCINo reflow phenomenonCardiologymedicineOriginal ArticleRadiology Nuclear Medicine and imagingMyocardial infarctionno reflowCardiology and Cardiovascular Medicinebusinessmyocardial perfusiontissue doppler imagingTIMIJournal of Cardiovascular Echography
researchProduct

New insights into symptomatic or silent atrial fibrillation complicating acute myocardial infarction

2015

International audience; Atrial fibrillation (AF) is the most frequent heart rhythm disorder in the general population and contributes not only to a major deterioration in quality of life but also to an increase in cardiovascular morbimortality. The onset of AF in the acute phase of myocardial infarction (MI) is a major event that can jeopardize the prognosis of patients in the short-, medium- and long-term, and is a powerful predictor of a poor prognosis after MI. The suspected mechanism underlying the excess mortality is the drop in coronary flow linked to the acceleration and arrhythmic nature of the left ventricular contractions, which reduce the left ventricular ejection fraction. The p…

medicine.medical_specialtyAsymmetric dimethylarginineSurveillance ECG en continueAsymétrique diméthylargininePopulationMyocardial InfarctionInfarctus du myocardeAcute myocardial infarctionSudden deathContinuous ECG monitoringVentricular Function Left[SHS]Humanities and Social SciencesHeart RateRisk FactorsInternal medicineCoronary CirculationHeart rateAtrial FibrillationmedicinePronosticHumansMyocardial infarctionHospital MortalityeducationHeart FailureFibrillation atriale silencieuseeducation.field_of_studyEjection fractionbusiness.industryAtrial fibrillationStroke VolumeGeneral MedicineStroke volumemedicine.diseasePrognosisMyocardial ContractionOxidative StressSilent atrial fibrillationHeart failureAsymptomatic DiseasesCardiologyEndothelium Vascular[SHS] Humanities and Social SciencesbusinessCardiology and Cardiovascular Medicine
researchProduct

Safety and efficacy of biodegradable polymer-coated thin strut sirolimus-eluting stent vs. durable polymer-coated everolimus-eluting stent in patient…

2018

Introduction The biodegradable polymer drug-eluting stents were developed to improve vascular healing. However, further data are needed to confirm the safety and efficacy of these stents in patients with acute myocardial infarction (AMI). Aim We sought to determine the 1-year clinical follow-up in patients with AMI treated with a thin strut biodegradable polymer-coated sirolimus-eluting stent (BP-SES) versus a durable coating everolimus-eluting stent (DP-EES). Material and methods We analyzed patients with AMI (STEMI and NSTEMI) treated with either a BP-SES (ALEX, Balton, Poland, n = 886) or DP-EES (XIENCE, Abbott, USA, n = 1054) with available 1-year clinical follow-up using propensity sco…

medicine.medical_specialtyEverolimus eluting stentmedicine.medical_treatmentacute myocardial infarctionlcsh:Medicine030204 cardiovascular system & hematology03 medical and health sciences0302 clinical medicinemedicineIn patientcardiovascular diseases030212 general & internal medicineMyocardial infarctionOriginal Paperbusiness.industrylcsh:Rdrug-eluting stentsStentPercutaneous coronary interventionequipment and suppliesmedicine.diseaseBiodegradable polymerSurgerybioabsorbable polymerSirolimusPropensity score matchingCardiology and Cardiovascular Medicinebusinessmedicine.drugAdvances in Interventional Cardiology
researchProduct

Five-year outcomes following timely primary percutaneous intervention, late primary percutaneous intervention, or a pharmaco-invasive strategy in ST-…

2019

Abstract Aims ST-segment elevation myocardial infarction (STEMI) guidelines recommend primary percutaneous coronary intervention (pPCI) as the default reperfusion strategy when feasible ≤120 min of diagnostic ECG, and a pharmaco-invasive strategy otherwise. There is, however, a lack of direct evidence to support the guidelines, and in real-world situations, pPCI is often performed beyond recommended timelines. To assess 5-year outcomes according to timing of pPCI (timely vs. late) compared with a pharmaco-invasive strategy (fibrinolysis with referral to PCI centre). Methods and results The French registry of Acute ST-elevation and non-ST-elevation Myocardial Infarction (FAST-MI) programme c…

medicine.medical_specialtyPercutaneousmedicine.medical_treatment[SDV]Life Sciences [q-bio]Myocardial InfarctionAcute myocardial infarction030204 cardiovascular system & hematology03 medical and health sciencesPercutaneous Coronary Intervention0302 clinical medicineReperfusion therapyFibrinolytic Agents[SDV.MHEP.CSC]Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemFibrinolysismedicineHumansST segment030212 general & internal medicineMyocardial infarctioncardiovascular diseasesTimingPrimary PCIbusiness.industryFibrinolysisHazard ratioPercutaneous coronary interventionmedicine.diseaseLong-term outcome3. Good health[SDV.MHEP.CSC] Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular system[SDV] Life Sciences [q-bio]Treatment OutcomeEmergency medicineConventional PCIST Elevation Myocardial InfarctionCardiology and Cardiovascular Medicinebusiness
researchProduct

Should we measure routinely the LDL peak particle size?

2004

Low density lipoproteins (LDL) do not show in humans a normal distribution and comprise two different main fractions: large, buoyant (phenotype pattern A) and small, dense (phenotype pattern B) particles, that differ not only in size and density but also in physicochemical composition, metabolic behaviour and atherogenicity. The prevalence of small, dense LDL changes with age (30-35% in adult men, 5-10% in men <20 years and in pre-menopausal women, 15-25% in postmenopausal women) and is genetically influenced, with a heritability ranging from 35% to 45%. Small, dense LDL correlate negatively with plasma HDL levels and positively with plasma triglyceride levels and are associated with the me…

medicine.medical_specialtySmall dense LDLAcute myocardial infarctionCoronary artery diseaseRisk FactorsDiabetes mellitusInternal medicineDiabetes MellitusmedicineHumansMyocardial infarctionParticle SizeRisk factorNational Cholesterol Education ProgramTriglyceridesMetabolic Syndromebusiness.industryVascular diseasePreventionmedicine.diseaseLipoproteins LDLCoronary heart diseasePhenotypeCardiovascular DiseasesAtherosclerosiCirculatory systemCardiologylipids (amino acids peptides and proteins)Metabolic syndromeLipoproteins HDLCardiology and Cardiovascular Medicinebusiness
researchProduct