Search results for "Angiotensin-Converting Enzyme"

showing 10 items of 159 documents

Relationship between low Ankle-Brachial Index and rapid renal function decline in patients with atrial fibrillation: a prospective multicentre cohort…

2015

Objective: To investigate the relationship between Ankle-Brachial Index (ABI) and renal function progression in patients with atrial fibrillation (AF). Design: Observational prospective multicentre cohort study. Setting: Atherothrombosis Center of I Clinica Medica of 'Sapienza' University of Rome; Department of Medical and Surgical Sciences of University Magna Græcia of Catanzaro; Atrial Fibrillation Registry for Ankle-Brachial Index Prevalence Assessment-Collaborative Italian Study. Participants: 897 AF patients on treatment with vitamin K antagonists. Main outcome measures: The relationship between basal ABI and renal function progression, assessed by the estimated Glomerular Filtration R…

RegistrieMaleAnkle brachial index atrial fibrillation renal functionCross-sectional studyAngiotensin-Converting Enzyme InhibitorsBlood PressureCardiovascular Medicineurologic and male genital diseasesKidneyRisk FactorsAtrial FibrillationOdds RatioSurveys and Questionnaireatrial fibrillation1506Prospective StudiesRenal InsufficiencyPractice Patterns Physicians'Prospective cohort studyMedicine (all)Atrial fibrillationGeneral MedicineMiddle Agedmedicine.anatomical_structureItalyHypertensioncardiovascular systemCardiologyDisease ProgressionFemaleVitamin K antagonistABICohort studyHumanGlomerular Filtration RateAnkle brachial index; atrial fibrillation; renal function1683medicine.medical_specialtyLogistic ModelNon-Vitamin K oral anticoagulantRenal functionrenal function declineAnkle-Brachial IndexNOInternal medicineAged; Angiotensin-Converting Enzyme Inhibitors; Atrial Fibrillation; Cross-Sectional Studies; Disease Progression; Female; Humans; Hypertension; Italy; Kidney; Logistic Models; Male; Middle Aged; Odds Ratio; Prospective Studies; Renal Insufficiency; Risk Factors; Ankle Brachial Index; Blood Pressure; Glomerular Filtration Rate; Medicine (all)medicineInternal MedicineHumansAnkle Brachial Indexcardiovascular diseasesIntensive care medicineAgedCross-Sectional StudieAntithrombotic therapybusiness.industryRisk FactorResearchrenal functionAnticoagulantAngiotensin-Converting Enzyme InhibitorOdds ratiomedicine.diseasebody regionsProspective StudieBlood pressureAtrial fibrillation; Ankle-Brachial Index; renal function declineCross-Sectional StudiesLogistic ModelsAnklebusinessABI renal function atrial fibrillation
researchProduct

Bond-based 3D-chiral linear indices: Theory and QSAR applications to central chirality codification

2008

The recently introduced non-stochastic and stochastic bond-based linear indices are been generalized to codify chemical structure information for chiral drugs, making use of a trigonometric 3D-chirality correction factor. These improved modified descriptors are applied to several well-known data sets to validate each one of them. Particularly, Cramer's steroid data set has become a benchmark for the assessment of novel quantitative structure activity relationship methods. This data set has been used by several researchers using 3D-QSAR approaches such as Comparative Molecular Field Analysis, Molecular Quantum Similarity Measures, Comparative Molecular Moment Analysis, E-state, Mapping Prope…

Stochastic ProcessesQuantitative structure–activity relationshipIndolesProperty (programming)ChemistryComparabilityQuantitative Structure-Activity RelationshipAngiotensin-Converting Enzyme InhibitorsStereoisomerismGeneral ChemistrySet (abstract data type)Data setComputational MathematicsModels ChemicalPiperidinesComputational chemistryDrug DesignBenchmark (computing)Molecular symmetryCombinatorial Chemistry TechniquesReceptors sigmaThermodynamicsTrigonometryAlgorithmJournal of Computational Chemistry
researchProduct

Asymptomatic Carotid Lesion as a Marker of Future Cerebrovascular and Cardiovascular Events

2003

Tunica mediamedicine.medical_specialtyAngiotensin-Converting Enzyme InhibitorsComorbidityAsymptomaticText miningRisk FactorsCarotid lesionmedicineHumansCarotid StenosisRandomized Controlled Trials as TopicEndarterectomy Carotidbusiness.industryGeneral MedicineStrokeCarotid Arteriesmedicine.anatomical_structureCardiovascular DiseasesHypertensionSurgeryThickeningRadiologyHydroxymethylglutaryl-CoA Reductase Inhibitorsmedicine.symptomTunica IntimabusinessPlatelet Aggregation InhibitorsActa Chirurgica Belgica
researchProduct

DNA damage response at telomeres boosts the transcription of SARS-CoV-2 receptor ACE2 during aging

2021

The severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) causes the coronavirus disease 2019 (COVID-19), known to be more common in the elderly, who also show more severe symptoms and are at higher risk of hospitalization and death. Here, we show that the expression of the angiotensin converting enzyme 2 (ACE2), the SARS-CoV-2 cell receptor, increases during aging in mouse and human lungs. ACE2 expression increases upon telomere shortening or dysfunction in both cultured mammalian cells and in vivo in mice. This increase is controlled at the transcriptional level, and Ace2 promoter activity is DNA damage response (DDR)-dependent. Both pharmacological global DDR inhibition of ATM kin…

ace2; covid-19; dna damage response; aging; telomere; aged; angiotensin-converting enzyme 2; animals; humans; mice; sars-cov-2; aging; covid-19; dna damage; telomeremiceCoronavirus disease 2019 (COVID-19)DNA damageSevere acute respiratory syndrome coronavirus 2 (SARS-CoV-2)BiologySettore MED/08 - Anatomia PatologicaBiochemistry03 medical and health sciences0302 clinical medicineDownregulation and upregulationPromoter activityTranscription (biology)angiotensin-converting enzyme 2GeneticsSettore MED/05 - Patologia ClinicaReceptorhumansMolecular Biology030304 developmental biology0303 health sciencestelomereAce2 aging COVID-19DNA damage response telomereagingace23. Good healthTelomereCell biologybody regionsdna damage responseanimalsagedsars-cov-2covid-19Angiotensin-converting enzyme 2Cancer researchdna damagehormones hormone substitutes and hormone antagonists030217 neurology & neurosurgery
researchProduct

An ab initio conformational study on captopril

2003

Abstract Captopril can interact regio- and stereo-specifically with various functional groups present at the active site of angiotensin converting enzyme (ACE). Since no X-ray structure of ACE is available, Captopril, as an ACE inhibitor may be used as a ‘molecular caliper’, to estimate upper and lower bound values for separation d, where the mercaptidic terminal group of the molecule is linked to the enzyme Zn2+ cofactor, while the carboxylate links via an hydrogen bond to the guanidine moiety of an arginine side chain. As the results of this Ab Initio study, the conformations of the dianionic form of the full captopril molecule are reported here.

biologyStereochemistryHydrogen bondAb initioActive siteCaptoprilAngiotensin-converting enzymeCondensed Matter PhysicsBiochemistrychemistry.chemical_compoundchemistryACE inhibitorbiology.proteinmedicineMoietyPhysical and Theoretical ChemistryGuanidinemedicine.drugJournal of Molecular Structure: THEOCHEM
researchProduct

Thermodynamics of the interaction between the spike protein of severe acute respiratory syndrome- coronavirus-2 and the receptor of human angiotensin…

2020

Since the end of 2019, the coronavirus SARS-CoV-2 has caused more than 180,000 deaths all over the world, still lacking a medical treatment despite the concerns of the whole scientific community. Human Angiotensin-Converting Enzyme 2 (ACE2) was recently recognized as the transmembrane protein serving as SARS-CoV-2 entry point into cells, thus constituting the first biomolecular event leading to COVID-19 disease. Here, by means of a state-of-the-art computational approach, we propose a rational evaluation of the molecular mechanisms behind the formation of the complex and of the effects of possible ligands. Moreover, binding free energy between ACE2 and the active Receptor Binding Domain (RB…

chemistry.chemical_classificationEnzymechemistrySevere acute respiratory syndrome coronavirus 2 (SARS-CoV-2)Angiotensin-converting enzyme 2medicineSpike ProteinComputational biologymedicine.disease_causeReceptorTransmembrane proteinCoronavirusProtein–protein interaction
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Does the renin-angiotensin system also regulate intra-ocular pressure?

2009

The renin-angiotensin-aldosterone system is known to play an essential role in controlling sodium balance and body fluid volumes, and thus blood pressure. In addition to the circulating system which regulates urgent cardiovascular responses, a tissue-localized renin-angiotensin system (RAS) regulates long-term changes in various organs. Many recognized RAS components have also been identified in the human eye. The highly vasoconstrictive angiotensin II (Ang II) is considered the key peptide in the circulatory RAS. However, the ultimate effect of RAS activation at tissue level is more complex, being based not only on the biological activity of Ang II but also on the activities of other produ…

medicine.medical_specialty030204 cardiovascular system & hematologyPeptide hormoneRenin-Angiotensin System03 medical and health sciences0302 clinical medicineInternal medicineRenin–angiotensin systemMedicineAnimalsHumansIntraocular Pressurebiologybusiness.industryAngiotensin-converting enzymeBiological activityGeneral MedicineWater-Electrolyte BalanceAngiotensin IIBiosynthetic PathwaysBlood pressureEndocrinologyACE inhibitorCirculatory system030221 ophthalmology & optometrybiology.proteinOcular Hypertensionbusinessmedicine.drugAnnals of medicine
researchProduct

An epidemiological study exploring a possible impact of treatment with ACE inhibitors or angiotensin receptor blockers on ACE2 plasma concentrations

2020

medicine.medical_specialty2019-20 coronavirus outbreakCoronavirus disease 2019 (COVID-19)business.industrySevere acute respiratory syndrome coronavirus 2 (SARS-CoV-2)COVID-19Angiotensin-Converting Enzyme InhibitorsPharmacologyPolymorphism Single NucleotideAngiotensin Receptor AntagonistsEpidemiologic StudiesRisk FactorsEpidemiologyPlasma concentrationmedicineHumansAngiotensin-Converting Enzyme 2Angiotensin Receptor BlockersCardiology and Cardiovascular MedicinebusinessMolecular BiologyJournal of Molecular and Cellular Cardiology
researchProduct

Changes of Angiotensin Converting Enzyme (Ace) Levels During Activation of the Renin-Angiotensin-Aldosterone System (RAAs)

1987

The aim of this study was to evaluate the changes of ACE levels during RAAs activation induced by: 1) a continuous graded bicycle ergometer test performed in a group of 15 males health youths aged between 21 and 30 years, with average age of 25.8 +/- 2.85 years; 2) i.m. injection of 20 mg of frusemide in 11 health youths (10 males and 1 female), aged between 20 and 30 years, with average age of 24.09 +/- 2.77 years; 3) dialytic treatment in 25 patients (12 males and 13 females), suffering from chronic renal failure, aged between 26 and 68 years, with average age of 54 +/- 15.42 years. Plasmatic renin activity (PRA), aldosterone (ALD) and ACE levels were determined by RIA in basal conditions…

medicine.medical_specialtyAldosteronebiologybusiness.industrymedicine.medical_treatmentAngiotensin-converting enzymePlasma renin activityBasal (phylogenetics)chemistry.chemical_compoundEndocrinologychemistryInternal medicineRenin–angiotensin systembiology.proteinMedicineChronic renal failureBicycle ergometerbusinessDialysis
researchProduct