Search results for "Angiotensin-converting enzyme inhibitor"

showing 10 items of 93 documents

Peripheral artery disease: potential role of ACE-inhibitor therapy

2008

Giuseppe Coppola, Giuseppe Romano, Egle Corrado, Rosa Maria Grisanti, Salvatore NovoDepartment of Internal Medicine, Cardiovascular and Nephro-Urological Diseases, Chair of Cardiovascular Disease, University of Palermo, Palermo, ItalyAbstract: Subjects with peripheral arterial disease (PAD) of the lower limbs are at high risk for cardiovascular and cerebrovascular events and the prevalence of coronary artery disease in such patients is elevated. Recent studies have shown that regular use of cardiovascular medications, such as therapeutic and preventive agents for PAD patients, seems to be promising in reducing long-term mortality and morbidity. The angiotensin-converting-enzyme (ACE) system…

Ramiprillcsh:Diseases of the circulatory (Cardiovascular) systemmedicine.medical_specialtyPathologyACE inhibitorsEndocrinology Diabetes and MetabolismBradykininAngiotensin-Converting Enzyme InhibitorsReviewDiseaseendothelial dysfunctionCoronary artery diseasechemistry.chemical_compoundperipheral arterial diseaseInternal medicineHumansMedicinePharmacology (medical)Endothelial dysfunctionCell ProliferationSubclinical infectionPeripheral Vascular Diseasesbusiness.industryFibrinolysisPublic Health Environmental and Occupational HealthCardiovascular AgentsPeripheral artery disease ACE-inhibitorintermittent claudicationHematologyGeneral Medicinemedicine.diseaseSettore MED/11 - Malattie Dell'Apparato Cardiovascolareperipheral arterial disease.Oxidative StressTreatment OutcomeLower ExtremitychemistryCardiovascular Diseaseslcsh:RC666-701ACE-inhibitorsACE inhibitorCardiovascular agentCardiologyEndothelium VascularatherosclerosisCardiology and Cardiovascular Medicinebusinessmedicine.drugVascular Health and Risk Management
researchProduct

Cost-effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post hoc analysis of SMI…

2013

Claudio Borghi,1 Ettore Ambrosioni,1 Stefano Omboni,2 Arrigo FG Cicero,1 Stefano Bacchelli,1 Daniela Degli Esposti,1 Salvatore Novo,3 Dragos Vinereanu,4 Giuseppe Ambrosio,5 Giorgio Reggiardo,6 Dario Zava7 1Unit of Internal Medicine, Policlinico S Orsola, University of Bologna, Bologna, Italy; 2Italian Institute of Telemedicine, Varese, Italy; 3Division of Cardiology, University of Palermo, Palermo, Italy; 4University and Emergency Hospital, Bucharest, Romania; 5Division of Cardiology, University of Perugia, Perugia, Italy; 6Mediservice, Milano, Italy; 7Istituto Lusofarmaco d'Italia SpA, Peschiera Borromeo, Italy Background: In SMILE-4 (the Survival of Myocardial Infarction Long-term…

Ramiprilmedicine.medical_specialtyCost effectivenessEconomics Econometrics and Finance (miscellaneous)Populationacute myocardial infarctionramiprilchemistry.chemical_compoundInternal medicinePost-hoc analysismedicinezofenoprilMyocardial infarctioneducationcost-effectivenesshealth care economics and organizationsOriginal Researchleft ventricular dysfunctioneducation.field_of_studylcsh:R5-920business.industryHealth Policylcsh:RM1-950acetylsalicylic acidmedicine.diseaseSMILE studycost effectiveness analysis (CEA)Confidence intervalZofenoprilangiotensin-converting enzyme inhibitorsClinicoEconomics and Outcomes Researchlcsh:Therapeutics. PharmacologychemistryCardiologyNumber needed to treatMedical emergencybusinesslcsh:Medicine (General)medicine.drug
researchProduct

Cardiovascular outcomes in patients at high cardiovascular risk with previous myocardial infarction or stroke.

2021

BACKGROUND Guidelines recommend to start blood pressure (BP)-lowering drugs also according to cardiovascular risk including history of cardiovascular events. We hypothesized that in patients with a history of myocardial infarction (MI), stroke, both or none of those, the index events predict the next event and have different SBP risk associations to different cardiovascular outcomes. DESIGN AND MEASUREMENTS In this pooled posthoc, nonprespecified analysis, we assessed outcome data from high-risk patients aged 55 years or older with a history of cardiovascular events or proven cardiovascular disease, randomized to the Ongoing Telmisartan Alone and in Combination with Ramipril Global Endpoint…

Ramiprilmedicine.medical_specialtyPhysiologyMyocardial InfarctionAngiotensin-Converting Enzyme InhibitorsRisk FactorsInternal medicineInternal MedicinemedicineHumansMyocardial infarctionStrokebusiness.industryProportional hazards modelHazard ratiomedicine.diseaseConfidence intervalClinical trialStrokeTreatment OutcomeCardiovascular DiseasesHeart Disease Risk FactorsCardiologyTelmisartanCardiology and Cardiovascular Medicinebusinessmedicine.drugJournal of hypertension
researchProduct

Renal outcomes and blood pressure patterns in diabetic and nondiabetic individuals at high cardiovascular risk

2021

Background Diabetes and hypertension are risk factors for renal and cardiovascular outcomes. Data on the association of achieved blood pressure (BP) with renal outcomes in patients with and without diabetes are sparse. We investigated the association of achieved SBP, DBP with renal outcomes and urinary albumin excretion (UAE) in people with vascular disease. Methods In this pooled analysis, we assessed renal outcome data from high-risk patients aged 55 years or older with a history of cardiovascular disease, 70% of whom had hypertension, randomized to The Ongoing Telmisartan Alone and in Combination with Ramipril Global Endpoint Trial and to Telmisartan Randomized Assessment Study in ACE In…

Ramiprilmedicine.medical_specialtyPhysiologyRenal functionAngiotensin-Converting Enzyme InhibitorsBlood Pressure030204 cardiovascular system & hematologyBenzoates03 medical and health scienceschemistry.chemical_compound0302 clinical medicineRisk FactorsInternal medicineDiabetes mellitusDiabetes MellitusInternal MedicinemedicineHumans030212 general & internal medicineCreatininebusiness.industryHazard ratioMiddle Agedmedicine.diseasechemistryCardiovascular DiseasesHeart Disease Risk FactorsHypertensionAlbuminuriaMicroalbuminuriamedicine.symptomTelmisartanCardiology and Cardiovascular Medicinebusinessmedicine.drugJournal of Hypertension
researchProduct

Randomised comparison of zofenopril and ramipril plus acetylsalicylic acid in postmyocardial infarction patients with left ventricular systolic dysfu…

2015

Objective Conflicting evidence exists on the benefits of treating patients with coronary artery disease and preserved left ventricular ejection fraction (LVEF) with an ACE inhibitor. This retrospective analysis of the SMILE-4 Study sought to compare the efficacy of zofenopril 60 mg plus acetylsalicylic acid (ASA) versus ramipril 10 mg plus ASA 100 mg in patients with acute myocardial infarction (AMI) and heart failure, according to an impaired or preserved LVEF. Methods The primary study end point was 1-year combined occurrence of death or hospitalisation for cardiovascular causes. A preserved LVEF was defined by a baseline LVEF >40% and an impaired one by an LVEF ≤40%. Results 448 patients…

Ramiprilmedicine.medical_specialtyacute myocardial infarctionInfarctionramiprilCoronary Artery DiseaseCoronary artery diseasechemistry.chemical_compoundInternal medicinemedicinezofenopril1506cardiovascular diseasesMyocardial infarctionleft ventricular dysfunctionEjection fractionbusiness.industryleft ventricular ejection fractionmedicine.diseaseZofenoprilangiotensin-converting enzyme inhibitorsangiotensin-converting enzyme inhibitorchemistryacute myocardial infarction; angiotensin-converting enzyme inhibitors; left ventricular dysfunction; left ventricular ejection fractionHeart failureACE inhibitorcardiovascular systemCardiologyCardiology and Cardiovascular Medicinebusinesscirculatory and respiratory physiologyBiomedical engineeringmedicine.drugOpen Heart
researchProduct

Cardiovascular outcomes and achieved blood pressure in patients with and without diabetes at high cardiovascular risk

2019

Abstract Aims Studies have shown a non-linear relationship between systolic blood pressure (SBP) and diastolic blood pressure (DBP) and outcomes, with increased risk observed at both low and high blood pressure (BP) levels. We hypothesized that the BP-risk association is different in individuals with and without diabetes at high cardiovascular risk. Methods and results We identified patients with (N = 11 487) or without diabetes (N = 19 450), from 30 937 patients, from 133 centres in 44 countries with a median follow-up of 56 months in the ONTARGET/TRANSCEND studies. Patients had a prior history of stroke, myocardial infarction (MI), peripheral artery disease, or were high-risk diabetics. P…

Ramiprilmedicine.medical_specialtyhypertensionSystoleAngiotensin-Converting Enzyme Inhibitors030204 cardiovascular system & hematologyPeripheral Arterial Disease03 medical and health sciences0302 clinical medicineRamiprilDiastoleRisk FactorsInternal medicineDiabetes mellitusDiabetes MellitusmedicineHumanshigh cardiovascular riskTelmisartan030212 general & internal medicineMyocardial infarctionStrokeRetrospective StudiesHeart Failurediabetesbusiness.industryHazard ratioblood pressureBlood Pressure Determinationmedicine.diseasestrokeHospitalizationmyocardial infarctionBlood pressureCardiovascular DiseasesCase-Control StudiesHeart failureCardiologyDrug Therapy CombinationTelmisartanCardiology and Cardiovascular MedicinebusinessAngiotensin II Type 1 Receptor Blockersmedicine.drugEuropean Heart Journal
researchProduct

Relationship between low Ankle-Brachial Index and rapid renal function decline in patients with atrial fibrillation: a prospective multicentre cohort…

2015

Objective: To investigate the relationship between Ankle-Brachial Index (ABI) and renal function progression in patients with atrial fibrillation (AF). Design: Observational prospective multicentre cohort study. Setting: Atherothrombosis Center of I Clinica Medica of 'Sapienza' University of Rome; Department of Medical and Surgical Sciences of University Magna Græcia of Catanzaro; Atrial Fibrillation Registry for Ankle-Brachial Index Prevalence Assessment-Collaborative Italian Study. Participants: 897 AF patients on treatment with vitamin K antagonists. Main outcome measures: The relationship between basal ABI and renal function progression, assessed by the estimated Glomerular Filtration R…

RegistrieMaleAnkle brachial index atrial fibrillation renal functionCross-sectional studyAngiotensin-Converting Enzyme InhibitorsBlood PressureCardiovascular Medicineurologic and male genital diseasesKidneyRisk FactorsAtrial FibrillationOdds RatioSurveys and Questionnaireatrial fibrillation1506Prospective StudiesRenal InsufficiencyPractice Patterns Physicians'Prospective cohort studyMedicine (all)Atrial fibrillationGeneral MedicineMiddle Agedmedicine.anatomical_structureItalyHypertensioncardiovascular systemCardiologyDisease ProgressionFemaleVitamin K antagonistABICohort studyHumanGlomerular Filtration RateAnkle brachial index; atrial fibrillation; renal function1683medicine.medical_specialtyLogistic ModelNon-Vitamin K oral anticoagulantRenal functionrenal function declineAnkle-Brachial IndexNOInternal medicineAged; Angiotensin-Converting Enzyme Inhibitors; Atrial Fibrillation; Cross-Sectional Studies; Disease Progression; Female; Humans; Hypertension; Italy; Kidney; Logistic Models; Male; Middle Aged; Odds Ratio; Prospective Studies; Renal Insufficiency; Risk Factors; Ankle Brachial Index; Blood Pressure; Glomerular Filtration Rate; Medicine (all)medicineInternal MedicineHumansAnkle Brachial Indexcardiovascular diseasesIntensive care medicineAgedCross-Sectional StudieAntithrombotic therapybusiness.industryRisk FactorResearchrenal functionAnticoagulantAngiotensin-Converting Enzyme InhibitorOdds ratiomedicine.diseasebody regionsProspective StudieBlood pressureAtrial fibrillation; Ankle-Brachial Index; renal function declineCross-Sectional StudiesLogistic ModelsAnklebusinessABI renal function atrial fibrillation
researchProduct

Bond-based 3D-chiral linear indices: Theory and QSAR applications to central chirality codification

2008

The recently introduced non-stochastic and stochastic bond-based linear indices are been generalized to codify chemical structure information for chiral drugs, making use of a trigonometric 3D-chirality correction factor. These improved modified descriptors are applied to several well-known data sets to validate each one of them. Particularly, Cramer's steroid data set has become a benchmark for the assessment of novel quantitative structure activity relationship methods. This data set has been used by several researchers using 3D-QSAR approaches such as Comparative Molecular Field Analysis, Molecular Quantum Similarity Measures, Comparative Molecular Moment Analysis, E-state, Mapping Prope…

Stochastic ProcessesQuantitative structure–activity relationshipIndolesProperty (programming)ChemistryComparabilityQuantitative Structure-Activity RelationshipAngiotensin-Converting Enzyme InhibitorsStereoisomerismGeneral ChemistrySet (abstract data type)Data setComputational MathematicsModels ChemicalPiperidinesComputational chemistryDrug DesignBenchmark (computing)Molecular symmetryCombinatorial Chemistry TechniquesReceptors sigmaThermodynamicsTrigonometryAlgorithmJournal of Computational Chemistry
researchProduct

Asymptomatic Carotid Lesion as a Marker of Future Cerebrovascular and Cardiovascular Events

2003

Tunica mediamedicine.medical_specialtyAngiotensin-Converting Enzyme InhibitorsComorbidityAsymptomaticText miningRisk FactorsCarotid lesionmedicineHumansCarotid StenosisRandomized Controlled Trials as TopicEndarterectomy Carotidbusiness.industryGeneral MedicineStrokeCarotid Arteriesmedicine.anatomical_structureCardiovascular DiseasesHypertensionSurgeryThickeningRadiologyHydroxymethylglutaryl-CoA Reductase Inhibitorsmedicine.symptomTunica IntimabusinessPlatelet Aggregation InhibitorsActa Chirurgica Belgica
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct