Search results for "Atomic"

showing 10 items of 27529 documents

Comparative Theoretical Analysis of BN Nanotubes Doped with Al, P, Ga, As, In, and Sb

2013

SUMMARY AND CONCLUDING REMARKS We have performed large-scale first-principles calculations ofthe electronic structure of (5,5) boron nitride nanotubescontaining the following substitutional impurity atoms: Al, P,Ga, As, In, and Sb. Calculations have been performed using thetwo methods: (i) linear combination of atomic orbitals(LCAO) with the atomic-centered Gaussian-type functions asa basis set and (ii) linearized augmented cylindrical wave(LACW) accompanied with the local density functional andmuffin-tin approximations for the electronic potential. In arelatively good qualitative agreement, both methods predict lowformation energies and, thus, relative stability of point defectsthat are assoc…

010302 applied physicsChemistryBand gap02 engineering and technologyElectronic structure021001 nanoscience & nanotechnology01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsBond lengthchemistry.chemical_compoundGeneral EnergyBoron nitrideLinear combination of atomic orbitals0103 physical sciencesDensity of statesPhysical and Theoretical ChemistryAtomic physics0210 nano-technologyElectronic band structureBasis setThe Journal of Physical Chemistry C
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Low energy nano diffraction (LEND) – A versatile diffraction technique in SEM

2019

Abstract Electron diffraction is a powerful characterization method that is used across different fields and in different instruments. In particular, the power of transmission electron microscopy (TEM) largely relies on the capability to switch between imaging and diffraction mode enabling identification of crystalline phases and in-depth studies of crystal defects, to name only examples. In contrast, while diffraction techniques have found their way into the realm of scanning electron microscopy (SEM) in the form of electron backscatter diffraction and related techniques, on-axis transmission diffraction is still in its infancy. Here we present a simple but versatile setup that enables a ‘…

010302 applied physicsDiffractionMaterials scienceGrapheneScanning electron microscopebusiness.industry02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesCrystallographic defectAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionCharacterization (materials science)Electron diffractionlawTransmission electron microscopy0103 physical sciencesOptoelectronics0210 nano-technologybusinessInstrumentationElectron backscatter diffractionUltramicroscopy
researchProduct

Fast-ADT: A fast and automated electron diffraction tomography setup for structure determination and refinement.

2020

Abstract Electron crystallography has focused in the last few years on the analyses of microcrystals, mainly organic compounds, triggered by recent publications on acquisition methods based on direct detection cameras and continuous stage tilting. However, the main capability of a transmission electron microscope is the access to features at the nanometre scale. In this context, a new acquisition method, called fast and automated diffraction tomography (Fast-ADT), has been developed in form of a general application in order to get the most of the diffraction space from a TEM. It consists of two subsequent tilt scans of the goniometric stage; one to obtain a crystal tracking file and a secon…

010302 applied physicsDiffractionMaterials scienceMicroscopeElectron crystallographybusiness.industryContext (language use)02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionDiffraction tomographyOpticsElectron diffractionlawGoniometer0103 physical sciences0210 nano-technologybusinessInstrumentationPowder diffractionUltramicroscopy
researchProduct

Quasi-parallel precession diffraction: Alignment method for scanning transmission electron microscopes.

2018

Abstract A general method to set illuminating conditions for selectable beam convergence and probe size is presented in this work for Transmission Electron Microscopes (TEM) fitted with µs/pixel fast beam scanning control, (S)TEM, and an annular dark field detector. The case of interest of beam convergence and probe size, which enables diffraction pattern indexation, is then used as a starting point in this work to add 100 Hz precession to the beam while imaging the specimen at a fast rate and keeping the projector system in diffraction mode. The described systematic alignment method for the adjustment of beam precession on the specimen plane while scanning at fast rates is mainly based on …

010302 applied physicsDiffractionMaterials sciencebusiness.industryDetector02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesDark field microscopyAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionOpticsElectron diffractionProjectorlaw0103 physical sciencesPrecessionElectron microscope0210 nano-technologybusinessInstrumentationBeam (structure)Ultramicroscopy
researchProduct

Superparamagnetic recoverable flowerlike Fe3O4@Bi2O3 core–shell with g-C3N4 sheet nanocomposite: synthesis, characterization, mechanism and kinetic s…

2019

In the present research study, a simple method was developed for the synthesis of three-dimensional flowerlike Fe3O4@Bi2O3 core–shell with g-C3N4 sheet nanocomposites. The X-ray diffraction, Fourier transform infrared spectroscopy, scanning electronic microscopy, transmission electron microscope, vibrating sample magnetometer, dynamic laser scattering analyzer and UV–Vis diffuse reflection spectroscopy were employed for the characterization of structure, purity and morphology of the resultant samples. The degradation of indigo carmine as a model of organic dye pollutant is applied for photo-catalytic activity. The parameters which are affecting the efficiency of various parameters, such as;…

010302 applied physicsDiffractionNanocompositeMaterials scienceKineticsAnalytical chemistryElectronCondensed Matter Physics01 natural sciencesAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialsflowerlike Fe3O4@Bi2O3 core-shell g-C3N4 superparamagnetic photocatalysischemistry.chemical_compoundIndigo carminechemistryTransmission electron microscopySettore CHIM/03 - Chimica Generale E Inorganica0103 physical sciencesSettore CHIM/07 - Fondamenti Chimici Delle TecnologieElectrical and Electronic EngineeringFourier transform infrared spectroscopySuperparamagnetism
researchProduct

Nonlinear optical response of bulk ZnO crystals with different content of intrinsic defects

2018

Abstract The nonlinear optical (NLO) properties of native defect-rich ZnO single crystals were studied in details within the excitation of the continuous wave (CW) and pulsed laser radiation at 532 nm (2.33 eV). Analysis of the experimental data of optical elastic scattering, Fourier transform infrared (FTIR), near infrared–visible–ultraviolet (NIR–Vis–UV) spectra recorded in reflection and absorption modes, and data of photoluminescence (PL) spectroscopy confirmed the contribution of both intrinsic defects and their clusters, being determined before by neutron diffraction and XRD analysis. It was shown that the high sensitivity of the NLO diagnostics via self-action of a laser beam is due …

010302 applied physicsElastic scatteringMaterials sciencePhotoluminescenceInfraredOrganic ChemistryNeutron diffraction02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesMolecular physicsAtomic and Molecular Physics and OpticsLight scatteringElectronic Optical and Magnetic MaterialsInorganic ChemistryWavelength0103 physical sciencesElectrical and Electronic EngineeringPhysical and Theoretical ChemistryFourier transform infrared spectroscopy0210 nano-technologySpectroscopySpectroscopyOptical Materials
researchProduct

RBS and ERD cross-sections and optical model parameters for the analysis of lithium, boron and nickel

2000

Abstract Elastic scattering cross-sections for RBS analysis of nickel by 7 Li and 11 B ion backscattering near the Coulomb barrier have been determined. The lithium ion measurements were performed in the energy range of 8–15 MeV at the laboratory angles of 115° and 135°. For boron ions the energies between 14 and 24 MeV and scattering angles of 89°, 110° and 130° were used. For the analysis of lithium and boron by ERD the scattering cross-sections have been calculated by kinematically reversing the backscattering process. The calculated 58 Ni ion energies thus varied between 65 and 125 MeV for lithium and between 75 and 130 MeV for boron recoils. For the Li + Ni and B + Ni systems the thres…

010302 applied physicsElastic scatteringNuclear and High Energy PhysicsScatteringchemistry.chemical_elementCoulomb barrier02 engineering and technology021001 nanoscience & nanotechnology7. Clean energy01 natural sciencesIonNickelsymbols.namesakechemistry0103 physical sciencessymbolsLithiumRutherford scatteringAtomic physics0210 nano-technologyBoronInstrumentationNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Modelling of expected B, C, N and O Lyman-α line intensities emitted from W7-X plasmas and measured by means of the W7-X light impurity monitor system

2021

AbstractThe “C/O Monitor” for Wendelstein 7-X (W7-X) is a dedicated light impurity XUV spectrometer intended to measure Lyman-α transitions of hydrogen-like ions of four low-Z impurities—boron (4.9 nm), carbon (3.4 nm), nitrogen (2.5 nm) and oxygen (1.9 nm). Since the discussed diagnostic will deliver continuous information about the line intensities, it is crucial to understand the origin of the obtained signals with respect to the experimental plasma conditions (electron temperature and density). This, however, might be difficult because of the broad acceptance angle of the spectrometer and irregular shape of the plasma edge or SOL where the radiation is expected to mostly come from, depe…

010302 applied physicsElectron densityMaterials scienceSpectrometerGeneral Physics and AstronomyPlasma01 natural sciences010305 fluids & plasmasIonRadiant fluxImpurityExtreme ultraviolet0103 physical sciencesElectron temperatureAtomic physics
researchProduct

Photo-electrical and transport properties of hydrothermal ZnO

2016

We performed the studies of optical, photoelectric, and transport properties of a hydrothermal bulk n-type ZnO crystal by using the contactless optical techniques: photoluminescence, light-induced transient grating, and differential reflectivity. Optical studies revealed bound exciton and defect-related transitions between the donor states (at ∼60 meV and ∼240 meV below the conduction band) and the deep acceptor states (at 0.52 eV above the valence band). The acceptor state was ascribed to VZn, and its thermal activation energy of 0.43 eV was determined. A low value of carrier diffusion coefficient (∼0.1 cm2/s) at low excitations and temperatures up to 800 K was attributed to impact the rec…

010302 applied physicsElectron mobilityPhotoluminescenceChemistryBand gapExcitonWide-bandgap semiconductorGeneral Physics and Astronomy02 engineering and technologyCarrier lifetime021001 nanoscience & nanotechnology01 natural sciencesAcceptorMolecular physicsCrystalCondensed Matter::Materials Science0103 physical sciencesAtomic physics0210 nano-technologyJournal of Applied Physics
researchProduct