Search results for "BODY-MASS"

showing 10 items of 42 documents

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of >…

Malemedicine.medical_specialtyChinaAdolescentUniversitiesPhysical fitnessPhysical activityIdeal Body Weight030209 endocrinology & metabolismBody-mass indexBody fat percentageBody compositionBody Mass Index03 medical and health sciencesYoung AdultSkeletal muscle mass0302 clinical medicineEpidemiologymedicineHumans030212 general & internal medicineObesityAssociation (psychology)Muscle SkeletalStudents2. Zero hungerPublic healthbusiness.industryPhysical activity4. Educationlcsh:Public aspects of medicinePublic Health Environmental and Occupational Healthlcsh:RA1-1270Test (assessment)Normal weight obesityPhysical FitnessFemalebusinessBody mass indexDemographyResearch ArticleBMC Public Health
researchProduct

Genome-wide association studies identify four ER negative-specific breast cancer risk loci

2013

Estrogen receptor (ER)-negative tumors represent 20-30% of all breast cancers, with a higher proportion occurring in younger women and women of African ancestry. The etiology and clinical behavior of ER-negative tumors are different from those of tumors expressing ER (ER positive), including differences in genetic predisposition. To identify susceptibility loci specific to ER-negative disease, we combined in a metaanalysis 3 genome-wide association studies of 4,193 ER-negative breast cancer cases and 35,194 controls with a series of 40 follow-up studies (6,514 cases and 41,455 controls), genotyped using a custom Illumina array, iCOGS, developed by the Collaborative Oncological Gene-environm…

Oncologygenetic associationbody-mass indexEstrogen receptorGenome-wide association studycancer riskBioinformaticssusceptibilitychromosome 1q0302 clinical medicineRisk Factorssingle nucleotide polymorphismGenotypeestrogenCooperative Behaviorcomparative studyOligonucleotide Array Sequence Analysis0303 health scienceschromosome 16q3. Good healthReceptors Estrogenpriority journal030220 oncology & carcinogenesisFemalecancer invasionsignal transductionbreast cancer; cancer invasion; cancer risk; chromosome 1; chromosome 16q; chromosome 1q; chromosome 2p; comparative study; follow up; gene locus; genetic association; genetic susceptibility; human; nucleotide sequence; priority journal; signal transduction; single nucleotide polymorphismmedicine.medical_specialtyGenotypegene locusBreast NeoplasmsSingle-nucleotide polymorphismBiologyPolymorphism Single NucleotideArticle03 medical and health sciencesBreast cancerbreast cancerMeta-Analysis as TopicSDG 3 - Good Health and Well-beingInternal medicineexpressionGeneticsmedicineGenetic predispositionHumansfollow upGenetic Predisposition to Diseasehumanchromosome 1gene030304 developmental biologyCase-control studyCancernucleotide sequencemedicine.diseasechromosome 2pGenetic LociCase-Control Studiescommon variantGenome-Wide Association Studygenetic susceptibilityNature Genetics
researchProduct

Does early onset asthma increase childhood obesity risk? A pooled analysis of 16 European cohorts

2018

The parallel epidemics of childhood asthma and obesity over the past few decades have spurred research into obesity as a risk factor for asthma. However, little is known regarding the role of asthma in obesity incidence. We examined whether early-onset asthma and related phenotypes are associated with the risk of developing obesity in childhood.This study includes 21 130 children born from 1990 to 2008 in Denmark, France, Germany, Greece, Italy, The Netherlands, Spain, Sweden and the UK. We followed non-obese children at 3-4 years of age for incident obesity up to 8 years of age. Physician-diagnosed asthma, wheezing and allergic rhinitis were assessed up to 3-4 years of age.Children with ph…

Pulmonary and Respiratory MedicineMaleAllergyPediatricsmedicine.medical_specialtyPediatric ObesityInfants -- MalaltiesCHILDRENOverweightPROFILEChildhood obesityArticleCohort Studies03 medical and health sciences0302 clinical medicineSDG 3 - Good Health and Well-beingRisk FactorsWheezemedicineHumans030212 general & internal medicineRisk factorAge of OnsetChildAsmaAsthmaRespiratory SoundsOVERWEIGHTbusiness.industryINCIDENT ASTHMAmedicine.diseaseObesityRhinitis AllergicAsthma3. Good healthrespiratory tract diseasesBODY-MASS INDEXALLERGYEuropePhenotype030228 respiratory systemChild PreschoolObesitatFemaleAge of onsetmedicine.symptombusiness
researchProduct

Transsacral rectocele following combined neurinoma resection: A case report

2015

Highlights • Case of a combined (transsacral and laparoscopic) resection of a presacral tumour. • First described case of a transsacral rectocele two years after this procedure. • Possibility of laparoscopic defect repair of transsacral defects.

S3/4 sacral segmentmedicine.medical_specialtyDefect repairPresacral tumourmedicine.diagnostic_testbusiness.industryTumor resectionTranssacral rectoceleAbdominotranssacral tumour resectionCase ReportMagnetic resonance imaging030230 surgeryLaparoscopic mesh graft implantationResectionSurgeryBMI body-mass-index03 medical and health sciences0302 clinical medicineText mining030220 oncology & carcinogenesisMedicineSurgerybusinessMRI magnetic resonance imagingSacral segmentInternational Journal of Surgery Case Reports
researchProduct

Predictor variables for half marathon race time in recreational female runners

2011

Import JabRef | WosArea General and Internal Medicine; International audience; INTRODUCTION: The relationship between skin-fold thickness and running performance has been investigated from 100 m to the marathon distance, except the half marathon distance. OBJECTIVE: To investigate whether anthropometry characteristics or training practices were related to race time in 42 recreational female half marathoners to determine the predictor variables of half-marathon race time and to inform future novice female half marathoners. METHODS: Observational field study at the 'Half Marathon Basel' in Switzerland. RESULTS: In the bivariate analysis, body mass (r = 0.60), body mass index (r = 0.48), body …

Time FactorsTRAINING CHARACTERISTICSPhysical fitnessLEVEL2700 General MedicineRunningEndurance0302 clinical medicineSkin fold030212 general & internal medicineSKINFOLD THICKNESSES2. Zero hungerlcsh:R5-920AnthropometryGeneral MedicineClinical ScienceCircumference3. Good healthSkinfold ThicknessSkinfold thicknessCIRCUMFERENCEBody fat[ SCCO.NEUR ] Cognitive science/NeuroscienceDISTANCE RUNNING PERFORMANCEFemalelcsh:Medicine (General)Adult11035 Institute of General Practicemedicine.medical_specialtyULTRAMARATHONERSeducationECONOMY610 Medicine & healthPredictor variablesAthletic PerformanceCAPACITY03 medical and health sciencesAthletemedicineHumansbusiness.industryUpper body[SCCO.NEUR]Cognitive science/NeuroscienceGender030229 sport sciencesAnthropometryBODY-MASSPhysical FitnessPhysical therapyRecreationUPPER ARMEpidemiologic MethodsbusinessBody mass indexhuman activities
researchProduct

Alcoholic beverages, obesity, physical activity and other nutritional factors, and cancer risk: A review of the evidence

2016

International audience; Purpose: Prevention is a priority in the fight against cancers, especially nutritional prevention. To update the levels of evidence of relationships between 10 nutritional factors and cancer risk, the scientific literature published from 2006 to 2014 was reviewed by an expert group.Methods: Data from 133 meta-analyses, pooled analyses or intervention trials were examined. Nearly 150 relationships between nutritional factors and cancer at various sites were evaluated.Results: According to the evidence graded as convincing or probable, these factors were divided in two groups. Factors which increase the risk of cancer are alcoholic beverages, overweight and obesity, re…

[SDV.MHEP.HEM] Life Sciences [q-bio]/Human health and pathology/HematologyGastric cardia adenocarcinomaBreastfeedingReviewOverweightDose-response metaanalysis[ SDV.CAN ] Life Sciences [q-bio]/Cancer0302 clinical medicineNeoplasmsPrimary liver-cancerBeta-carotene supplementsBody-mass Index[ SDV.MHEP.HEM ] Life Sciences [q-bio]/Human health and pathology/HematologyCruciferous vegetables intakeDeveloping lung-cancer030212 general & internal medicineCancer2. Zero hungerProcessed meat consumptionAlcoholic Beverages[SDV.MHEP.HEM]Life Sciences [q-bio]/Human health and pathology/HematologyHematologyRenal-cell cancer3. Good healthOncology030220 oncology & carcinogenesisRandomized controlled-trialsRed meatmedicine.symptomAlcoholAlcohol;Beta-carotene supplements;Breastfeeding;Cancer;Diet;Obesity;Physical activity;PreventionBreastfeeding[SDV.CAN]Life Sciences [q-bio]/CancerMotor Activity03 medical and health sciences[SDV.CAN] Life Sciences [q-bio]/CancerEnvironmental healthmedicineHumansObesityExerciseCancer preventionbusiness.industryPhysical activityPreventionCancerEvidence-based medicinemedicine.diseaseObesityBeta-carotene supplementationBiotechnologyDietGeriatrics and GerontologybusinessBody mass indexCritical Reviews in Oncology/Hematology
researchProduct

A century of trends in adult human height

2016

Article

estatura corporalEpidemiologyComputingMilieux_LEGALASPECTSOFCOMPUTINGmedical research;pituuskasvuGlobal Healthmedical research0302 clinical medicineadultsPublic health surveillanceBiology (General)ComputingMilieux_MISCELLANEOUSheight ; global ; trendsPOPULATIONHuman Nutrition & Healthbiological sciences;education.field_of_studyEVOLUÇÃO HUMANAbiological sciencesHumane Voeding & GezondheidGeneral MedicineadultoHälsovetenskaperBiological sciencesnutritionOF-THE-LITERATUREMedicineGROWTHHEALTHPublic HealthHumanQH301-705.5ScienceSECULAR CHANGESSocio-culturaleGeneral Biochemistry Genetics and Molecular Biology03 medical and health sciencesEpidemiology; Public HealthMedical researchNoneHealth SciencesHumansHuman heighteducationVLAGNeuroscience (all)Biochemistry Genetics and Molecular Biology (all)Adult human heightCHILD UNDERNUTRITION030104 developmental biologyBody mass index030217 neurology & neurosurgeryheightDemography0301 basic medicineSettore MED/09 - Medicina InternaNutrition and DiseaseImmunology and Microbiology (all)[SDV]Life Sciences [q-bio]humanosbiological sciences; epidemiology; global health; medical research; none; nutritionVoeding en ZiekteStature -- History -- 20th centuryMedicine and Health SciencesBiological sciencesaikuisetGeneral NeuroscienceQRPublic Health Global Health Social Medicine and EpidemiologyBody sizenone;biological sciences; epidemiology; global health; medical research; none; nutrition; Adult; Global Health; Humans; Body Height; Neuroscience (all); Biochemistry Genetics and Molecular Biology (all); Immunology and Microbiology (all)epidemiology;Adult height//purl.org/pe-repo/ocde/ford#3.01.03 [https]Research Articletrendsglobal health;AdultSTATURESouth asia//purl.org/pe-repo/ocde/ford#1.06.03 [https]Stature TallPopulationGlobal healthJournal ArticleLife ScienceGeneral Immunology and Microbiologybiological science//purl.org/pe-repo/ocde/ford#3.01.04 [https]Quarter (United States coin)Body HeighttrenditBODY-MASS INDEXFolkhälsovetenskap global hälsa socialmedicin och epidemiologikorkeusEpidemiology and Global HealthCancer incidenceCANCER INCIDENCEWEIGHT
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Metabolic mediators of the effects of body-mass index, overweight, and obesity on coronary heart disease and stroke: a pooled analysis of 97 prospect…

2014

Summary Background Body-mass index (BMI) and diabetes have increased worldwide, whereas global average blood pressure and cholesterol have decreased or remained unchanged in the past three decades. We quantified how much of the effects of BMI on coronary heart disease and stroke are mediated through blood pressure, cholesterol, and glucose, and how much is independent of these factors. Methods We pooled data from 97 prospective cohort studies that collectively enrolled 1·8 million participants between 1948 and 2005, and that included 57 161 coronary heart disease and 31 093 stroke events. For each cohort we excluded participants who were younger than 18 years, had a BMI of lower than 20 kg/…

medicine.medical_specialtySettore MED/09 - Medicina InternaNutrition and Diseasenoncommunicable diseasesbariatric surgeryscientific statementcardiovascular-diseaseCoronary DiseaseOverweightsystematic analysisBody Mass Indexblood-pressureInternal medicineDiabetes mellitusVoeding en ZiektemedicineHumansProspective cohort studyrisk-factorsStrokeVLAGHuman Nutrition & HealthGlobal NutritionWereldvoedingFramingham Risk Scorebusiness.industryHumane Voeding & GezondheidArticlesGeneral MedicineOverweightmedicine.diseaseObesityStrokeBlood pressurerandomized-trialsPhysical therapyCardiologyall-cause mortalitymedicine.symptombusinessBody mass indexbody-mass index obesity coronary heart disease strokeweight-loss
researchProduct

EMAS position statement: Predictors of premature and early natural menopause.

2019

Simoncini, Tommaso/0000-0002-2971-0079; Chung, Hsin-Fang/0000-0003-3261-5942; Mishra, Gita/0000-0001-9610-5904 WOS:000468709100014 PubMed ID: 31027683 Introduction: While the associations of genetic, reproductive and environmental factors with the timing of natural menopause have been extensively investigated, few epidemiological studies have specifically examined their association with premature (< 40 years) or early natural menopause (40-45 years). Aim: The aim of this position statement is to provide evidence on the predictors of premature and early natural menopause, as well as recommendations for the management of premature and early menopause and future research. Materials and methods…

medicine.medical_treatmentMenopause PrematureTwinsPremature ovarian insufficiencyOVARIAN DEVELOPMENT0302 clinical medicine3123 Gynaecology and paediatricsPregnancyRisk FactorsEpidemiology030212 general & internal medicineFamily historyAetiology030219 obstetrics & reproductive medicineObstetricsEstrogen Replacement TherapySmokingObstetrics and Gynecology3. Good healthEarly menopauseMenopauseParityMenarcheFemaleUnderweightmedicine.symptomMenopausemedicine.medical_specialtyPremature ovarian insufficiencyGeneral Biochemistry Genetics and Molecular Biology03 medical and health sciencesAGEThinnessmedicineHumansPrematureMenarchePregnancyLIFE-COURSEbusiness.industryREPRODUCTIVE PERIODBody Weightmedicine.diseaseCOGNITIVE FUNCTIONBIRTH-WEIGHTAetiology; Early menopause; Premature ovarian insufficiency; Risk factors; Body Weight; Estrogen Replacement Therapy; Female; Humans; Menarche; Pregnancy; Risk Factors; Smoking; Thinness; Twins; Menopause; Menopause Premature; ParityBODY-MASS INDEXRisk factorsRISK-FACTORSHormone therapyCIGARETTE-SMOKINGbusinessSOCIOECONOMIC POSITIONMaturitas
researchProduct