Search results for "CONST"

showing 10 items of 7706 documents

Experimental Analysis of the Thermal Performance of Wood Fiber Insulating Panels

2023

During the last decades, attention to energy and environmental problems has significantly grown, along with the development of international and national policies addressing sustainability issues. In the construction sector, one of the most widespread energy efficiency strategies consists of thermal insulation of buildings thanks to external insulating panels. Among these, wood fiber is an insulating material characterized by a natural, eco-sustainable and biodegradable structure, coming from the recycling of waste wood from sawmills. The present study aimed to characterize small test building insulated with wood fiber panels from the thermal point of view, comparing the results with those …

experimental campaignwood fiber sustainable materials sustainable building thermal behavior experimental campaignSettore ING-IND/11 - Fisica Tecnica Ambientalesustainable buildingwood fiberRenewable Energy Sustainability and the Environmentsustainable materialsGeography Planning and Developmentthermal behaviorBuilding and ConstructionManagement Monitoring Policy and Lawsustainable materialSustainability
researchProduct

External sustainability in Spanish economy: bubbles and crises, 1970–2020

2023

We address the issue of the sustainability Spain’s exter-nal debt, using data for the period 1970–2020. To detect episodes of potentially explosive behavior of the Spanish net foreign assets over GDP ratio and the current account balance over GDP ratio, as well as episodes of external adjustments over this long period, we employ a recursive unit root test approach. Our empirical analysis leads us to conclude that there is some evidence of bubbles in the ratio between Spanish net foreign assets and the GDP. In contrast, the evidence that the ratio between the Spanish current account balance and the GDP had explosive subperiods is very weak. The episode of explosive behavior identified in the…

external imbalancesrecursive unit root testGeography Planning and Developmentintertemporal external budget constraintHC Economic History and ConditionsUNESCO::CIENCIAS ECONÓMICASDevelopmentexplosivenesssustainability
researchProduct

Toward the Development of Load Transfer Efficiency Evaluation of Rigid Pavements by a Rolling Wheel Deflectometer

2020

The jointed rigid pavement is currently evaluated by the Falling weight deflectometer which is rather slow for the testing of the jointed pavements. Continuous nondestructive evaluation of rigid pavements with a rolling wheel deflectometer can be used to measure the load transfer and is investigated. Load transfer is an important indicator of the rigid pavement&rsquo

falling weight deflectometerComputer science0211 other engineering and technologies02 engineering and technologylcsh:TechnologyNondestructive testing021105 building & construction0502 economics and businesssemi-analytical modelGeneral Materials ScienceJoint (geology)Civil and Structural Engineering050210 logistics & transportationrolling wheel deflectometerlcsh:Tbusiness.industry05 social sciencesrigid pavementBuilding and ConstructionStructural engineeringGeotechnical Engineering and Engineering GeologyComputer Science ApplicationsContinuous dataFalling weight deflectometerTransfer efficiencyjointsload transferDevelopment (differential geometry)businessInfrastructures
researchProduct

Enquête sur l’atelier : histoire, fonctions, transformations

2014

Une stylisation de l’histoire de l’atelier d’artiste fait dependre ses fonctions du degre d’individualisation du travail createur, des innovations esthetiques et de l’economie de la production artistique. La periodisation qui suit fournit une trame sommaire. Indistinction entre art et artisanat d’abord : les ateliers sont situes dans les monasteres, dans les demeures des mecenes de la cour ou se confondent avec le domicile ou avec la boutique d’artisan en ville. Variabilite croissante des emp...

familleconstructionHistoryworkshopfamilyVisual Arts and Performing Artsfemmeart market[SHS]Humanities and Social SciencesatelierworkcréationcreationprofessionComputingMilieux_MISCELLANEOUSsociabilitéeducationchantiermétierformation[SHS.ART]Humanities and Social Sciences/Art and art historymarchépeintureapprentissagepaintingsociabilitytravail[SHS.ART] Humanities and Social Sciences/Art and art historycorporationwomen
researchProduct

Instytucja zaprzeczenia ojcostwa - między teorią a praktyką w prawie polskim

2019

Artykuł powstał z uwagi na przypadki spraw o zaprzeczenie ojcostwa, z jakimi autorka miała styczność w dotychczasowej pracy w kancelarii prawnej. Czas na wytoczenie przez mężczyznę powództwa o zaprzeczenie ojcostwa lub o ustalenie bezskuteczności uznania ojcostwa jest krótki i wynosi 6 miesięcy. Ponadto po jego upłynięciu jedyną możliwością z perspektywy ojca jest wytoczenie powództwa przez prokuratora, który de facto nie musi się przychylić do wniosku mężczyzny i może odmówić tej czynności. Jednak w żadnym z tych przypadków ustalenie więzów biologicznych między ojcem a dzieckiem nie jest jeszcze przesądzone. Jeśli matka dziecka wyraża zgodę na badania DNA, które jednoznacznie wykluczają oj…

family lawthe European Court of Human Rightszaprzeczenie ojcostwaEuropejski Trybunał Praw CzłowiekaPolish jurisprudenceTrybunał Konstytucyjnydenial of paternityorzecznictwo polskieprawo rodzinnethe Constitutional TribunalSecurity Economy & Law. Scientific Journal for Students and PhD. Candidates
researchProduct

Exploring identity construction in bilingual families

2017

Tämän pro gradu-tutkielman tarkoituksena on tarkastella kahden kaksikielisen perheen jäsenten identiteetin rakentumista. Vaikka kaksikielisyyttä perheissä on tutkittu laajalti, identiteetin rakentumisen näkökulmasta tutkimuksia on suhteellisen vähän. Tutkimus on luonteeltaan laadullinen ja tavoitteena oli selvittää miten perheenjäsenet kuvaavat identiteettiään ja identifioituvat kieliinsä sekä millaisia identiteettejä he rakentavat itselleen. Identiteettiin liittyen, tukielma halusi myös vastata kysymyksiin kielen käytöstä sekä tunteiden ilmaisemisesta. Tutkielma myös tarkastelee mahdollisia eroja ja yhtäläisyyksiä identiteettien välillä sukupolvien sekä sisarusten kesken. Lähtökohtana tutk…

familykaksikielisyysidentiteettiperhebilingualismidentity constructionidentity
researchProduct

Modeling the influence of potassium content and heating rate on biomass pyrolysis

2017

This study presents a combined kinetic and particle model that describes the effect of potassium and heating rate during the fast pyrolysis of woody and herbaceous biomass. The model calculates the mass loss rate, over a wide range of operating conditions relevant to suspension firing. The shrinking particle model considers internal and external heat transfer limitations and incorporates catalytic effects of potassium on the product yields. Modeling parameters were tuned with experimentally determined char yields at high heating rates (>200 K s−1) using a wire mesh reactor, a single particle burner, and a drop tube reactor. The experimental data demonstrated that heating rate and potassium …

fast pyrolysisParticle modelheating rate020209 energyPotassiumchemistry.chemical_elementBiomass02 engineering and technologyManagement Monitoring Policy and LawEnergy engineeringMetaplast0202 electrical engineering electronic engineering information engineeringmetaplastWaste managementpotassiumMechanical EngineeringHerbaceous biomassBuilding and ConstructionHeating ratePulp and paper industryKineticsGeneral EnergychemistrykineticsHeat transferPotassiumParticle sizePyrolysisFast pyrolysis
researchProduct

Exploiting Data Analytics and Deep Learning Systems to Support Pavement Maintenance Decisions

2021

Road networks are critical infrastructures within any region and it is imperative to maintain their conditions for safe and effective movement of goods and services. Road Management, therefore, plays a key role to ensure consistent efficient operation. However, significant resources are required to perform necessary maintenance activities to achieve and maintain high levels of service. Pavement maintenance can typically be very expensive and decisions are needed concerning planning and prioritizing interventions. Data are key towards enabling adequate maintenance planning but in many instances, there is limited available information especially in small or under-resourced urban road authorit…

feature importancepavement management systemComputer science0211 other engineering and technologiespavement maintenance decision02 engineering and technologypavement management systemslcsh:Technologylcsh:ChemistryGoods and services021105 building & construction0502 economics and business11. SustainabilitySettore ICAR/04 - Strade Ferrovie Ed AeroportiGeneral Materials Scienceroad asset databasesInstrumentationlcsh:QH301-705.5Fluid Flow and Transfer Processes050210 logistics & transportationbusiness.industryLevel of servicelcsh:TProcess Chemistry and TechnologyDeep learning05 social sciencesGeneral EngineeringPavement managementdeep learningTimelinedata mininglcsh:QC1-999Computer Science Applicationsroad asset databaseWorkflowRisk analysis (engineering)lcsh:Biology (General)lcsh:QD1-999lcsh:TA1-2040Key (cryptography)Settore ICAR/17 - DisegnoArtificial intelligencepavement maintenance decisionsbusinesslcsh:Engineering (General). Civil engineering (General)Predictive modellinglcsh:PhysicsApplied Sciences
researchProduct

Introduction to Mathematical Logic (Edition 2017)

2017

Hyper-textbook for students in mathematical logic, Edition 2017

first order logiclogicresolution methodpredicate logicMathematicsofComputing_GENERALresolutionintuitionistic logicHerbrand theorempropositional logicmodel theoryconstructive logicData_FILESComputingMilieux_COMPUTERSANDEDUCATIONnormal formsmathematical logicHardware_ARITHMETICANDLOGICSTRUCTUREScompleteness theorem
researchProduct

El cuerpo materno en la red: entre el orden de lo ?deseable? y el de lo real

2019

El estilo de vida fitness se realiza en, y a través de, un entramado subjetivo y de poder en el que circulan y se ensamblan dispositivos empresariales, terapéuticos, sanitarios y de espectacularización de los cuerpos, tendientes a inscribir la vida de la población en las tramas conflictivas de un capitalismo heterosexista, neoliberal e informacional. En dicho marco, la temporalidad, metamorfosis y plasticidad del cuerpo materno irrumpe como problema y objeto de intervención de tecnologías diversas orientadas a ajustar su tamaño, forma y devenir a los parámetros de la vida activa y saludable. En escenarios digitales, dicha tensión se materializa, por un lado, a través de dispositivos visuale…

fitmomsanitaryproductivitythis tension is performedmaternidadesentre el orden de lo ?deseable? y el de lo real Landa [1137-7038 8537 Arxius de sociologia 558787 2019 41 7605686 El cuerpo materno en la red]tending to inscribe the life of the population in the conflictive plots of a heterosexistdispositive 135 156focusing mainly on the differences between a body that is presented as a fictional adaptation to the order of the ?desirable? and another that intends to make visible the constitutive vulnerability of the maternal process. The analysis shows how the management and exhibition of the maternal body in the net is marked by the imperatives of healthNúria The fitness lifestyle is carried out in and through a subjective and power framework in which businessMaría Inésembodied hyperbolically in the figure of the fit mom. And on the other handdispositivoUNESCO::SOCIOLOGÍAmaternidadmothers who question the hegemonic ?desirable? maternal figures in the digital scenario through exhibition of the realness of ther bodies and images of and ?self-acceptance?. The paper explores images and narratives in these two positions1137-7038 8537 Arxius de sociologia 558787 2019 41 7605686 El cuerpo materno en la red: entre el orden de lo ?deseable? y el de lo real Landa//purl.org/becyt/ford/5 [https]cuerpos realeshealth:SOCIOLOGÍA [UNESCO]bodymaternityand body spectacularization dispositifs circulate and are assembledas well as those of authenticity and extimacy cuerpofitnessCalafell Salatherapeuticand plasticity of the mother?s body arises as a problem and the object of the intervention of diverse technologies aimed at adjusting its size and shape to the parameters of an active and healthy life. In digital scenariossaludthrough visual and discursive dispositifs that promote the ideal of fitnessneoliberal and informational capitalism. Within this frameworkredes socialesthe temporalityand performance//purl.org/becyt/ford/5.8 [https]mutationon the one hand
researchProduct