Search results for "Convulsants"

showing 10 items of 125 documents

Time course of adverse events most commonly associated with topiramate for migraine prevention

2007

The efficacy, safety and tolerability of topiramate has been demonstrated in three large multicenter, randomized, double-blind, placebo-controlled trials. To characterize the time course of adverse events (AEs) that led to treatment discontinuation in/=2% of patients who received topiramate 100 mg/day during three pivotal, multicenter, randomized, double-blind, placebo-controlled, and 26-week trials. The pooled population comprised all randomized patients who reported safety data during the double-blind phase (topiramate 100 mg/day, n = 386; placebo n = 372), which consisted of a 4-week titration period and a 22-week maintenance period. Incidence, time to onset, and cumulative mean rate of …

AdultMaleTopiramateTime FactorsNauseaMigraine DisordersPopulationFructosePlaceboTimelaw.inventionPlacebosDouble-Blind MethodRandomized controlled trialTopiramatelawmedicineHumansParesthesiaeducationFatigueeducation.field_of_studyDose-Response Relationship Drugbusiness.industryNauseaMiddle Agedmedicine.diseaseAnorexiaDiscontinuationWithholding TreatmentNeurologyTolerabilityMigraineAnesthesiaPatient ComplianceAnticonvulsantsFemaleNeurology (clinical)medicine.symptomCognition Disordersbusinessmedicine.drugEuropean Journal of Neurology
researchProduct

Auditory event-related potentials (P300) in epileptic patients.

2001

Auditory event-related potentials (AERPs) were recorded during an auditory oddball paradigm in 108 epileptics and in 32 healthy controls. P300 latency varied in relationship with age only in controls. Symptomatic epileptics had significantly prolonged P300 mean latency compared to those without detectable brain lesion(s) on MR scan. Moreover, these latter patients were compared on the basis of epilepsy duration, type of seizure, seizure frequency and antiepileptic treatment; the application of a multiple regression model showed a significant relationship between P300 latency prolongation and epilepsy duration, seizure frequency and polytherapy.

AdultMalemedicine.medical_specialtyAdolescentAuditory eventAuditory oddballAudiologyCentral nervous system diseaseEpilepsyCognitionEvent-related potentialSeizuresPhysiology (medical)medicineHumansLatency (engineering)ChildAgedSeizure frequencyEpilepsyGeneral MedicineMiddle Agedmedicine.diseaseEvent-Related Potentials P300NeurologyEvoked Potentials AuditoryBrain lesionsRegression AnalysisAnticonvulsantsFemaleNeurology (clinical)PsychologyNeurophysiologie clinique = Clinical neurophysiology
researchProduct

Use of gabapentin to reduce chronic neuropathic pain in Fabry disease.

2003

The effect of the anticonvulsant gabapentin on neuropathic pain was studied in six male patients with Fabry disease, aged 15-45 years. After 4 weeks of treatment, pain, as measured using the Brief Pain Inventory, was decreased compared with baseline. Treatment was generally well tolerated. This study indicates that gabapentin should be considered as a treatment option for the neuropathic pain of Fabry disease.

AdultMalemedicine.medical_specialtyDiabetic neuropathyGabapentinAdolescentCyclohexanecarboxylic Acidsmedicine.medical_treatmentAcetatesGeneticsmedicineHumansBrief Pain InventoryAminesGenetics (clinical)gamma-Aminobutyric AcidPain Measurementbusiness.industryVascular diseaseEnzyme replacement therapymedicine.diseaseFabry diseaseSurgeryAnticonvulsantTreatment OutcomeAnesthesiaNeuropathic painFabry DiseaseNeuralgiaAnticonvulsantsGabapentinbusinessmedicine.drugJournal of inherited metabolic disease
researchProduct

Non-fatal and fatal liver failure associated with valproic acid.

2012

Little is known about hepatotoxicity associated with valproic acid (VPA), a widely used substance in neuropsychiatry.All reported cases to the German Federal Institute for Drugs and Medical Devices between 1993 and 2009 of VPA-induced serious hepatic side effects were evaluated.A total of 132 cases of serious VPA-associated liver failure were identified. Approximately one third (34.8%) occurred under VPA monotherapy, while the majority was seen with VPA plus co-medication, most frequently antiepileptics (34.8%) and benzodiazepines (16.7%). A subgroup of 34 cases (25.8%) had a fatal outcome, the largest number reported to date. Of these, 32.4% were under VPA monotherapy and 67.6% under VPA p…

AdultMalemedicine.medical_specialtyFatal outcomeAdolescentGastroenterologyBenzodiazepinesPharmacovigilancePharmacotherapyInternal medicineGermanyPharmacovigilancemedicineHumansPharmacology (medical)ChildAgedAged 80 and overValproic Acidbusiness.industryValproic AcidLiver failureInfantGeneral MedicineMiddle AgedPsychiatry and Mental healthAnesthesiaConcomitantChild Preschoollipids (amino acids peptides and proteins)AnticonvulsantsDrug Therapy CombinationFemaleChemical and Drug Induced Liver Injurybusinessmedicine.drugPharmacopsychiatry
researchProduct

Oxidative stress markers in the neocortex of drug-resistant epilepsy patients submitted to epilepsy surgery

2013

Summary Purpose While there is solid experimental evidence of brain oxidative stress in animal models of epilepsy, it has not been thoroughly verified in epileptic human brain. Our purpose was to determine and to compare oxidative stress markers in the neocortex of epileptic and non-epileptic humans, with the final objective of confirming oxidative stress phenomena in human epileptic brain. Methods Neocortical samples from drug-resistant epilepsy patients submitted to epilepsy surgery ( n =20) and from control, non-epileptic cortex samples ( n =11) obtained from brain bank donors without neurological disease, were studied for oxidative stress markers: levels of reactive oxygen species (ROS)…

AdultMalemedicine.medical_specialtyGlutathione reductaseNeocortexBiologymedicine.disease_causeLipid peroxidationSuperoxide dismutasechemistry.chemical_compoundEpilepsyInternal medicinemedicineHumansTreatment Failurechemistry.chemical_classificationGlutathione PeroxidaseReactive oxygen speciesEpilepsySuperoxide DismutaseGlutathione peroxidaseMiddle AgedCatalasemedicine.diseasePsychosurgeryOxidative StressGlutathione ReductaseEndocrinologyNeurologyBiochemistrychemistryCatalaseRetreatmentbiology.proteinAnticonvulsantsFemaleNeurology (clinical)BiomarkersOxidative stressEpilepsy Research
researchProduct

Drug-induced pertubation of the aminothiol redox-status in patients with epilepsy: improvement by B-vitamins.

2008

Summary Objectives Patients with epilepsy have excess morbidity and mortality due to ischemic cardiovascular disease. Many of these patients have elevated concentrations of plasma total homocysteine (Hcy), which is an acknowledged risk factor for cardiovascular disease, venous thromboembolic disease, foetal malformations and dementia. Hyperhomocysteinemia may have negative effects through mechanisms involving oxidative damage. In the present study, we have investigated the aminothiol redox-status in patients on antiepileptic drugs. Thereafter, in a subset of patients with elevated total Hcy, we evaluated the effect of B-vitamin therapy. Methods In the first part of the study, 101 patients o…

AdultMalemedicine.medical_specialtyHyperhomocysteinemiaHomocysteinemedicine.medical_treatmentRiboflavinHyperhomocysteinemiaRiboflavinchemistry.chemical_compoundFolic AcidMethionineVitamin B DeficiencyInternal medicinemedicineHumansCysteineMethionineEpilepsybusiness.industryValproic AcidCase-control studyPyridoxineDipeptidesmedicine.diseasePyridoxineSurgeryB vitaminsEndocrinologyAnticonvulsantCarbamazepineNeurologychemistryLiverCase-Control StudiesPhenobarbitalPhenytoinDrug EvaluationAnticonvulsantsFemaleNeurology (clinical)businessOxidation-ReductionPrimidonemedicine.drugEpilepsy research
researchProduct

Relation between Sexual Dysfunctions and Epilepsy, Type of Epilepsy, Type of Antiepileptic Drugs: A Prospective Study

2017

Introduction The aim of this study was to evaluate the incidence of sexual dysfunctions in males with epilepsy, the type of epilepsy, the frequency of seizures, the type of antiepileptic drugs (AEDs), the serum hormonal profile and the presence of psychiatric comorbidity. Methods Sixty-one patients focused on type of epilepsy, frequency of seizures, AEDs, hormonal profile and presence of mood disorders. We excluded all patients with severe neurologic and psychiatric impairment and patient who were not able to fill questionnaires. Mean age was 31.2 years (range 18-50 years); 31 patients (50.8%) had an idiopathic generalised epilepsy and 30 (49.2%) a focal epilepsy; among them, latter 18 (60%…

AdultMalemedicine.medical_specialtyPediatricsAdolescentSexual dysfunctionSettore MED/24 - UrologiaYoung Adult03 medical and health sciencesEpilepsyTestosterone blood0302 clinical medicinemedicineHumansTestosteroneSex hormonesProspective StudiesSexual Dysfunctions PsychologicalYoung adultProspective cohort studyPsychiatryEpilepsybusiness.industryIncidenceIncidence (epidemiology)Testosterone (patch)General MedicineCarbamazepineMiddle Agedmedicine.disease030227 psychiatrySexual Dysfunction PhysiologicalCarbamazepineSexual dysfunctionAnticonvulsantsSettore MED/26 - Neurologiamedicine.symptombusiness030217 neurology & neurosurgerymedicine.drugUrologia Journal
researchProduct

Comparative neurocognitive effects of lithium and anticonvulsants in long-term stable bipolar patients

2015

Background: The aim of choosing a mood-stabilizing drug (lithium or anticonvulsants) or a combination of them with minimal neurocognitive effects is to stimulate the development of criteria for a therapeutic adequacy, particularly in Bipolar Disorder (BD) patients who are clinically stabilized. Method: Three groups of BD patients were established according to their treatment: (i) lithium monotherapy (n=29); (ii) lithium together with one or more anticonvulsants (n=28); and (iii) one or more anticonvulsants (n=16). A group of healthy controls served as the control (n=25). The following tests were applied: Wechsler Adult Intelligence Scale, Trail Making Test, Wechsler Memory Scale, Rey Comple…

AdultMalemedicine.medical_specialtyWechsler Memory ScaleBipolar DisorderTrail Making TestNeuropsychological TestsAudiologyExecutive FunctionYoung Adult03 medical and health sciences0302 clinical medicineVisual memoryWisconsin Card Sorting TestAntimanic AgentsmedicineHumansAttentionWorking memoryWechsler Adult Intelligence ScaleMiddle AgedExecutive functions030227 psychiatryPsychiatry and Mental healthClinical PsychologyMemory Short-TermLithium CompoundsAnticonvulsantsDrug Therapy CombinationFemaleCognition DisordersPsychologyNeurocognitive030217 neurology & neurosurgeryClinical psychologyJournal of Affective Disorders
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Epilepsy in the Elderly

2009

Epilepsy is the third most common disease affecting the brain in the elderly. Current demographic trends will lead to an increased prevalence of epilepsy in the general population.A selective literature search revealed 102 relevant publications as of September 2008, 50 of which were original articles.The level of evidence was found to be very low. No guidelines, systematic reviews or meta-analyses are available, and there have been only three randomized, double-blind trials of treatment for epilepsy in the elderly. The seizures often escape clinical attention, because premonitory symptoms (aura) and secondary generalization into tonic-clonic seizures are both rarer in older patients. On the…

Aged 80 and overGeriatricsmedicine.medical_specialtyEpilepsyStatement (logic)business.industryConflict of interestDiagnostic testGeriatric assessmentReview ArticleGeneral Medicinemedicine.diseaseEpilepsymedicineHumansAnticonvulsantsPsychiatrybusinessGeriatric AssessmentAgedDeutsches Ärzteblatt international
researchProduct