Search results for "Cyclotron"

showing 10 items of 320 documents

Space Charge Effects in a Gas Filled Penning Trap

2001

Mass selective buffer gas cooling is a technique used for ions that are stored in a Penning trap. The technique can be applied to all elements and the mass resolving power achieved has proven to be sufficient to resolve isobars. When not only a few but 106 and more ions are stored at the same time, space charge starts to play a dominant role for the spatial distribution. In addition, the observed cyclotron frequency is shifted. This work investigates these effects by numerical calculations.

Work (thermodynamics)ChemistrylawBuffer gasCyclotronIsobarIon trapAtomic physicsPenning trapSpace chargeIonlaw.invention
researchProduct

Mass spectrometric study of oligourea macrocycles and their anion binding behavior

2009

Two series, one of tris-urea macrocycles and another of hexakis-urea macrocycles, are examined by (tandem) Fourier-transform ion cyclotron resonance (FTICR) mass spectrometry with respect to their fragmentation patterns and anion binding properties. All macrocycles are based on two different building blocks, one of which is a very rigid xanthene unit and the other one is a more flexible diphenyl ether. The composition and the sequence of these units thus determine their flexibility. During the fragmentation of deprotonated oligourea macrocycles in the gas phase, one urea N-CO bond is cleaved followed by a scrambling reaction within the macrocycle structure. Consequently, fragments are obser…

Xanthenechemistry.chemical_compoundCrystallographychemistryFragmentation (mass spectrometry)Hydrogen bondSupramolecular chemistryAnalytical chemistryAnion bindingIon cyclotron resonance spectrometrySpectroscopyFourier transform ion cyclotron resonanceIon cyclotron resonanceJournal of Mass Spectrometry
researchProduct

Prospects for advanced electron cyclotron resonance and electron beam ion source charge breeding methods for EURISOL

2011

International audience; As the most ambitious concept of isotope separation on line (ISOL) facility, EURISOL aims at producing unprecedented intensities of post-accelerated radioactive isotopes. Charge breeding, which transforms the charge state of radioactive beams from 1+ to an n+ charge state prior to postacceleration, is a key technology which has to overcome the following challenges: high charge states for high energies, efficiency, rapidity and purity. On the roadmap to EURISOL, a dedicated R&D is being undertaken to push forward the frontiers of the present state-of-the-art techniques which use either electron cyclotron resonance or electron beam ion sources. We describe here the gui…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceplasmafysiikka01 natural sciences7. Clean energyElectron cyclotron resonanceIonlaw.inventionIsotope separationelectron beamsNuclear physicsEURISOLion sourceslaw0103 physical sciencescyclotron resonance010306 general physicsradioactive ion beamsradioactive beamInstrumentation010302 applied physicsPhysicsta11429.25.Ni 41.75.Fr 07.77.KaionilähteetParticle acceleratorradioaktiiviset suihkutIon sourceCathode rayAtomic physicsydinfysiikkaIon cyclotron resonance
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Optimal control and shortcuts to adiabaticity techniques in linear and non-linear systems : from ion cyclotron resonance to nuclear magnetic resonance

2021

The goal of our research is to develop efficient and robust control protocols for classical and quantum systems. To this end, we have applied optimal control theory (OCT) and shortcuts to adiabaticity (STA) with inverse engineering and motion planning approaches in three different examples, which are RC (Resistor Capacitor) circuits, Fourier Transform-Ion Cyclotron Resonance (FT-ICR), and Nuclear Magnetic Resonance (NMR). Some of our results are not limited to these systems but are rather general. We apply OCT and STA with an inverse engineering approach to control the time-evolution of the charge on a capacitor. We show that OCT is a member of the family of STA solutions. In order to contr…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Résonance magnétique nucléaireShortcuts to adiabaticitySystèmes linéairesContrôle optimalLinear systemsIon cyclotron resonanceRésonance cyclotronique ioniqueRobust pulsesImpulsions robustesOptimal controlNuclear magnetic resonanceRaccourcis à l'adiabaticité
researchProduct

Natural oxygenation of Champagne wine during ageing on lees: A metabolomics picture of hormesis

2016

International audience; The oxygenation of Champagne wine after 4 and 6 years of aging on lees in bottle was investigated by FTICR-MS and UPLC-Q-TOF-MS. Three levels of permeability were considered for the stoppers, ranging from 0.2 to 1.8 mg/L/year of oxygen transfer rate. Our results confirmed a good repeatability of ultrahigh resolution FTICR-MS, both in terms of m/z and coefficient of variation of peak intensities among biological replicates. Vintages appeared to be the most discriminated features, and metabolite annotations suggested that the oldest wines (2006) were characterized by a higher sensitivity towards oxygenation. Within each vintage, the oxygenation mechanisms appeared to b…

business.product_categoryTime FactorsChampagne wineMass-spectrometryWineNetwork01 natural sciencesLeesMass SpectrometryAnalytical ChemistryGechanisms[SDV.IDA]Life Sciences [q-bio]/Food engineeringMetabolitesChromatography High Pressure LiquidUltra-performance liquid chromatography-mass spectrometryPrincipal Component AnalysisChemistry[ SDV.IDA ] Life Sciences [q-bio]/Food engineeringDiscriminant Analysisfood and beverages04 agricultural and veterinary sciencesGeneral Medicine040401 food scienceGlutathionePhenolicsVintageEvolutionSparkling winesDirect injection Fourier transform ion cyclotron resonance mass spectrometry0404 agricultural biotechnologyMetabolomicsHormesisPhytoalexinsOxidationBottleHumansMetabolomicsLeast-Squares AnalysisWineChromatography010401 analytical chemistryHormesisReproducibility of ResultsOxygenationInterfaceSulfur-dioxide0104 chemical sciencesOxygenFood StorageAgeingbusinessFood Science
researchProduct

2018

Whisky can be described as a complex matrix integrating the chemical history from the fermented cereals, the wooden barrels, the specific distillery processes, aging, and environmental factors. In this study, using Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR-MS) and liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS), we analyzed 150 whisky samples from 49 different distilleries, 7 countries, and ranging from 1 day new make spirit to 43 years of maturation with different types of barrel. Chemometrics revealed the unexpected impact of the wood history on the distillate's composition during barrel aging, regardless of the whisky origin. Flavonols, ol…

chemistry.chemical_classification010401 analytical chemistry04 agricultural and veterinary sciencesGeneral ChemistryTandem mass spectrometryBarrel (unit)040401 food science01 natural sciencesFourier transform ion cyclotron resonance0104 chemical sciencesChemometrics0404 agricultural biotechnologyFlavonolsMetabolomicschemistryLiquid chromatography–mass spectrometryPolyphenolFood scienceFrontiers in Chemistry
researchProduct

Periodic Beam Current Oscillations Driven by Electron Cyclotron Instabilities in ECRIS Plasmas

2014

Experimental observation of cyclotron instabilities in electron cyclotron resonance ion source plasma operated in cwmode is reported. The instabilities are associated with strong microwave emission and a burst of energetic electrons escaping the plasma, and explain the periodic oscillations of the extracted beam currents. The instabilities are shown to restrict the parameter space available for the optimization of high charge state ion currents. nonPeerReviewed

cyclotron instabilitiesPhysics::Plasma PhysicsAstrophysics::High Energy Astrophysical PhenomenaPhysics::Space PhysicsECRIS plasma
researchProduct

The NUMEN project @ LNS : Status and perspectives

2017

The aim of the NUMEN project is to access the Nuclear Matrix Elements (NME), involved in the half life of the neutrinoless double beta decay (0νββ), by measuring the cross sections of Heavy Ions (HI) induced Double Charge Exchange (DCE) reactions with high accuracy. First evidence of the possibility to get quantitative information about NME from experiments is shown in the reaction 40Ca(18O,18Ne)40Ar at 270 MeV, performed with MAGNEX spectrometer using Superconducting Cyclotron (CS) beams at INFN - Laboratory Nazionali del Sud (LNS) in Catania. Preliminary tests on 116Sn and 116Cd target are already performed. High beam intensity is the new frontiers for these studies. peerReviewed

cyclotrons nuclear structurespektroskopiaradioactive decaycharge exchange reactions
researchProduct

A no-carrier-added 72Se/72As radionuclide generator based on distillation

2004

Abstract Arsenic-72 is a positron emitting isotope with promising properties for syntheses of 72As-labelled radiopharmaceuticals for future application in positron emission tomography. This work describes the radiochemical separation of no-carrier-added 72Se from cyclotron irradiated germanium targets and the development of a 72Se/72As radionuclide generator, avoiding the addition of any selenium carrier. Using a vertical quartz tube device, no-carrier-added 72As is nearly quantitatively released from various chloride salt solutions containing 72Se within 10 min at a temperature of 100 °C in an HCl gas flow. The kinetics of the 72Se/72As isotope generator has been studied in relation to tem…

distillationSe-72IsotopeChemistryCyclotronRadiochemistrychemistry.chemical_elementGermaniumJlaw.inventionradionuclide generatorPositronlawddc:540As-72IrradiationPhysical and Theoretical ChemistryRadionuclide GeneratorDistillationSeleniumRadiochimica Acta
researchProduct