Search results for "DIAGNOSTICS"

showing 10 items of 197 documents

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Molecular diagnostics in gastric cancer.

2014

Despite recent advances in individualised targeted therapy, gastric cancer remains one of the most challenging diseases in gastrointestinal oncology. Modern imaging techniques using endoscopic filter devices and in vivo molecular imaging are designed to enable early detection of the cancer and surveillance of patients at risk. Molecular characterisation of the tumour itself as well as of the surrounding inflammatory environment is more sophisticated in the view of tailored therapies and individual prognostic assessment. The broad application of high throughput techniques for the description of genome wide patterns of structural (copy number aberrations, single nucleotide polymorphisms, meth…

business.industrymedicine.medical_treatmentCancerDiseaseComputational biologyProteomicsMolecular diagnosticsmedicine.diseaseTargeted therapyGene expression profilingMolecular Diagnostic TechniquesStomach NeoplasmsmicroRNAMedicineHumansMolecular imagingbusinessFrontiers in bioscience (Landmark edition)
researchProduct

Photoelectron Emission from Metal Surfaces Induced by Radiation Emitted by a 14 GHz Electron Cyclotron Resonance Ion Source

2015

Photoelectron emission measurements have been performed using a room-temperature 14 GHz ECR ion source. It is shown that the photoelectron emission from Al, Cu, and stainless steel (SAE 304) surfaces, which are common plasma chamber materials, is predominantly caused by radiation emitted from plasma with energies between 8 eV and 1 keV. Characteristic X-ray emission and bremsstrahlung from plasma have a negligible contribution to the photoelectron emission. It is estimated from the measured data that the maximum conceivable photoelectron flux from plasma chamber walls is on the order of 10% of the estimated total electron losses from the plasma. peerReviewed

010302 applied physicsMaterials scienceta114Physics::Instrumentation and DetectorsAstrophysics::High Energy Astrophysical PhenomenaCyclotron resonanceBremsstrahlungFOS: Physical sciencesPlasmaElectronphotoelectron emissionRadiation01 natural sciences7. Clean energyElectron cyclotron resonanceIon sourcePhysics - Plasma Physics010305 fluids & plasmasPlasma Physics (physics.plasm-ph)Physics::Plasma Physics0103 physical scienceselectron cyclotron resonance ion sourcesPlasma diagnosticsAtomic physicsInstrumentation
researchProduct

Effect of Intravenous IgM-Enriched Immunoglobulins on Presepsin and Other Sepsis Biomarkers

2021

Patients in septic shock with low IgG and IgM serum concentrations have higher mortality rates compared to those with normal immunoglobulin levels and, therefore, there is a rational explanation to administer intravenous IgM-enriched immunoglobulins to septic patients in ICU. Aim of this study is to evaluate the effectiveness of intravenous IgM-enriched immunoglobulins in decreasing several sepsis biomarker concentrations. 26 sepsis patients were enrolled in this observational cohort study and Nitric Oxide, Endocan, Pentraxin and presepsin serum levels were measured during their first 3 days of ICU stay. The use of intravenous IgM-enriched immunoglobulins did not influence the temporal evol…

medicine.medical_specialtysepsis - diagnosticsPopulationseptic shock (MeSH)presepsin (soluble CD14-subtype)RM1-950elderlyGastroenterologyNitric oxideSepsischemistry.chemical_compoundInternal medicineimmunoglobulin MmedicinePharmacology (medical)educationPharmacologyeducation.field_of_studybiologybusiness.industrySeptic shockBrief Research Reportmedicine.diseaseelderly; immunoglobulin M; presepsin (soluble CD14-subtype); sepsis - diagnostics; septic shock (MeSH)chemistryImmunoglobulin Mbiology.proteinBiomarker (medicine)Therapeutics. PharmacologyAntibodybusinessCohort studyFrontiers in Pharmacology
researchProduct

Statistical issues in the development of an automotive on-board diagnostics

2008

The automotive on-board diagnostics (OBD) is a complex system whose aim is to monitor the state-of-health of another complex system, i.e. the vehicle engine. OBD aimed at the containment of polluting exhaust emissions is nowadays compulsory on every vehicle model introduced into the market. Increasingly stringent regulations and ever more demanding customers push from opposite sides towards a perfect working of OBD systems. Therefore manufacturers are globally interested in the high robustness and reliability of such critical systems. The aim of this presentation is to give an insight into the main statistical problems arisen during an extensive research project carried out in collaboration…

Robust DesignSettore SECS-S/02 - Statistica Per La Ricerca Sperimentale E TecnologicaOn-Board Diagnostics
researchProduct

Expression of transketolase TKTL1 predicts colon and urothelial cancer patient survival: Warburg effect reinterpreted

2006

Abstract Tumours ferment glucose to lactate even in the presence of oxygen (aerobic glycolysis; Warburg effect). The pentose phosphate pathway (PPP) allows glucose conversion to ribose for nucleic acid synthesis and glucose degradation to lactate. The nonoxidative part of the PPP is controlled by transketolase enzyme reactions. We have detected upregulation of a mutated transketolase transcript (TKTL1) in human malignancies, whereas transketolase (TKT) and transketolase-like-2 (TKTL2) transcripts were not upregulated. Strong TKTL1 protein expression was correlated to invasive colon and urothelial tumours and to poor patients outcome. TKTL1 encodes a transketolase with unusual enzymatic prop…

Maleaerobic glycolysiCancer ResearchAdenocarcinomanPentose phosphate pathwayTransketolaseBiologyMetastasispentose phosphate pathway (PPP)Downregulation and upregulationPredictive Value of TestsmedicineHumansNeoplasm InvasivenessGlycolysisNeoplasm MetastasisMolecular Diagnosticsaerobic glycolysisAgedtransketolase-like-1 (TKTL1)transketolase (TKT)Gene Expression ProfilingCancerMiddle AgedPrognosismedicine.diseaseSurvival AnalysisWarburg effectUp-RegulationUrinary Bladder NeoplasmsOncologyBiochemistryAnaerobic glycolysispharmacodiagnostic markerColonic NeoplasmsCancer researchFemaleWarburg effectTransketolaseGlycolysisBritish Journal of Cancer
researchProduct

Modular Breath Analyzer (MBA): Introduction of a Breath Analyzer Platform Based on an Innovative and Unique, Modular eNose Concept for Breath Diagnos…

2021

Exhaled breath analysis for early disease detection may provide a convenient method for painless and non-invasive diagnosis. In this work, a novel, compact and easy-to-use breath analyzer platform with a modular sensing chamber and direct breath sampling unit is presented. The developed analyzer system comprises a compact, low volume, temperature-controlled sensing chamber in three modules that can host any type of resistive gas sensor arrays. Furthermore, in this study three modular breath analyzers are explicitly tested for reproducibility in a real-life breath analysis experiment with several calibration transfer (CT) techniques using transfer samples from the experiment. The experiment …

calibration transferComputer scienceRespiratory SystemPharmaceutical ScienceOrganic chemistrycorrelation alignment01 natural scienceseNoseAnalytical Chemistry0302 clinical medicineQD241-441DDC 570 / Life sciencesDrug Discoverybreath analysisSensortechnikdigestive oral and skin physiologyAtemgasanalyseMischoxideExhalationChemistry (miscellaneous)piecewise direct standardization030220 oncology & carcinogenesisElektronische NaseCalibrationMolecular MedicineMOX sensorsSpectrum analyzerAdolescentlow sensing chamber volumeReal-time computingstandard samplesbreath samplingArticleElectronic nose03 medical and health sciencesddc:570Breath testsCalibrationHumansddc:610Physical and Theoretical ChemistryReproducibilitybusiness.industry010401 analytical chemistryBreath samplingpattern recognitionBreath diagnosticsAtemluftModular design0104 chemical sciencesBreath analyzerBreath gas analysisbusinessBiosensing techniquesDDC 610 / Medicine & healthBiomarkersMolecules
researchProduct

Diagnostic system based on the T.r.u.e. Methodology (Termography, Radar, Ultrasound, Endoscopy) and its applications

2013

Il poster 1 è dedicato alla Metodologia T.R.U.E., che persegue l'obiettivo di supportare la progettazione del restauro, con particolare riferimento alla conservazione delle superfici di finitura e nel rispetto del valore di autenticità materiale delle architetture storiche. Poster number 1 is dedicated to the T.R.U.E. Methodology, that pursues the finality to elaborate the project for the conservation of the architectural surfaces and, in general, the respect of the authenticity of the materials stratified on the monumental architectures.

Diagnostica conservazione beni culturaliSettore ICAR/19 - RestauroDiagnostics conservation cultural heritage
researchProduct

Finte Pietre. Architettura dell'apparire e conservazione dei valori culturali

2012

Il volume presenta gli esiti di una ricerca incentrata sulla conoscenza delle finiture architettoniche di pietra artificiale, con particolare attenzione agli intonaci brevettati nel 1901 dai fratelli Li Vigni. Le attività di studio sono condotte attraverso la ricognizione dei documenti conservati presso l’Archivio Centrale dello Stato a Roma, e compiono una rigorosa selezione e analisi dei brevetti con l’obiettivo di tracciare il percorso evolutivo dei metodi d’intonacatura ed evidenziare i legami che s’instaurano tra le ricerche in corso nei diversi paesi. Nel XIX secolo i ricercatori di molte nazionalità avviano una selezione critica delle ricette tramandate dal passato e perfezionano pro…

Restauro pietra artificiale superficie intonaco malta calce sabbia cemento diagnosticaRestauration pierre artificielle surface plâtre mortier chaux sable ciment diagnosticSettore ICAR/19 - RestauroRestoration artificial stone surface plaster mortar lime sable cement diagnostics
researchProduct

The relationship between visible light emission and species fraction of the hydrogen ion beams extracted from 2.45 GHz microwave discharge.

2015

The relationship between Balmer-α and Fulcher-band emissions with extracted H + , H + 2 , and H + 3 ions is demonstrated for a 2.45 GHz microwave discharge. Ion mass spectra and optical measurements of Balmer-α and Fulcher-band emissions have been obtained with a Wien Filter having an optical viewport on the plasma chamber axis. The beam of approximately 1 mA is analyzed for different plasma conditions simultaneously with the measurement of light emissions both with temporal resolution. The use of visible light emissions as a valuable diagnostic tool for monitoring the species fraction of the extracted beams is proposed. peerReviewed

plasma sourcesMaterials scienceWien filterta114Astrophysics::High Energy Astrophysical Phenomenaelektrodition beamsAstrophysics::Cosmology and Extragalactic AstrophysicsPlasmaelectrodesIonion sourcesPhysics::Plasma PhysicsTemporal resolutionMass spectrumPlasma diagnosticsAtomic physicsInstrumentationvisible lightAstrophysics::Galaxy AstrophysicsMicrowaveVisible spectrumThe Review of scientific instruments
researchProduct