Search results for "Evaporation"

showing 10 items of 175 documents

Atomic Layer Deposition and Properties of Lanthanum Oxide and Lanthanum-Aluminum Oxide Films

2006

Atomic layer deposition (ALD) of lanthanum oxide on glass and silicon substrates was examined using lanthanum silylamide, La[N(SiMe 3 ) 2 ] 3 , and water as precursors in the substrate temperature range of 150-250 °C. The effect of pulse times and precursor evaporation temperature on the growth rate and refractive index was investigated. The films remained amorphous regardless of the deposition conditions. The resulting La 2 O 3 films contained noticeable amounts of hydrogen and silicon and were chemically unstable while stored in ambient air. Lanthanum aluminum oxide films were achieved with stoichiometry close to that of LaAlO 3 at 225°C from La[N(SiMe 3 ) 2 ] 3 , Al(CH 3 ) 3 , and H 2 O.…

010302 applied physicsLanthanideSiliconProcess Chemistry and TechnologyInorganic chemistrychemistry.chemical_element02 engineering and technologySurfaces and InterfacesGeneral ChemistrySubstrate (electronics)021001 nanoscience & nanotechnology01 natural sciencesEvaporation (deposition)Amorphous solidAtomic layer depositionchemistry.chemical_compoundchemistryLanthanum oxide0103 physical sciencesLanthanum0210 nano-technologyChemical Vapor Deposition
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Comparison of gap-filling techniques applied to the CCI soil moisture database in Southern Europe

2021

Abstract Soil moisture (SM) is a key variable that plays an important role in land-atmosphere interactions. Monitoring SM is crucial for many applications and can help to determine the impact of climate change. Therefore, it is essential to have continuous and long-term databases for this variable. Satellite missions have contributed to this; however, the continuity of the series is compromised due to the data gaps derived by different factors, including revisit time, presence of seasonal ice or Radio Frequency Interference (RFI) contamination. In this work, the applicability of different gap-filling techniques is evaluated on the ESA Climate Change Initiative (CCI) SM combined product, whi…

010504 meteorology & atmospheric sciencesDatabaseCorrelation coefficient0208 environmental biotechnologySoil ScienceGeology02 engineering and technologycomputer.software_genre01 natural sciencesNormalized Difference Vegetation Index020801 environmental engineeringRandom forestSupport vector machineAutoregressive modelPrincipal component analysisPotential evaporationComputers in Earth Sciencescomputer0105 earth and related environmental sciencesMathematicsInterpolationRemote sensingRemote Sensing of Environment
researchProduct

Soil evaporation monitoring : a possible synergism of microwave and infrared remote sensing

1995

Abstract Microwave remote sensing allows the measurement of the water content (θs) at the soil surface within a layer of a few centimetres. When combined with climatic data, θs is a relevant quantity to estimate the evaporation of bare soils. The implementation of a simple daily evaporation (Ed) model on bare soils based on a knowledge of θs is analysed. In order to cover a wide range of soil, soil moisture and climatic conditions, the analysis was carried out on a set of data simulated by a mechanistic model of heat and water flows in the soil. Propagation error analysis on the inputs (θs, daily potential evaporation and wind velocity) of the simple model shows that an accuracy of ± 1.5 mm…

010504 meteorology & atmospheric sciencesMoisture[SDV]Life Sciences [q-bio]0207 environmental engineeringEvaporationSoil science02 engineering and technologySoil type01 natural sciencesPhysics::Geophysics[SDV] Life Sciences [q-bio]Soil waterPotential evaporationEnvironmental sciencePrecipitation020701 environmental engineeringWater contentPhysics::Atmospheric and Oceanic PhysicsMicrowaveComputingMilieux_MISCELLANEOUS0105 earth and related environmental sciencesWater Science and TechnologyRemote sensing
researchProduct

Evaporation from soils of different texture covered by layers of water repellent and wettable soils

2020

Water repellent soils are able to channel water deep into the soil profile by fingered flow, minimising water storage in the water repellent top layer where water is most susceptible to evaporation. To date, the effect of water repellent or wettable surface layer on evaporation from wet sublayer has only been reported for coarse materials, and an increase in water repellency led to a greater delay in water evaporation. The objective of this study was to assess the effect of water repellent vs. wettable top layers with different thickness on water evaporation from coarse and fine texture subsoils that were pre-moistened. Clay loam soil samples were taken from Pinus pinaster woodland of Ciavo…

0106 biological sciences0301 basic medicineSoil testSettore AGR/13 - Chimica AgrariaEvaporationEvaporationDuffSoil sciencePlant Science01 natural sciencesBiochemistry03 medical and health sciencesSoilGeneticsSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-ForestaliSurface layerMolecular BiologyEcology Evolution Behavior and SystematicsbiologyWater storageCell Biologybiology.organism_classificationPineWater repellency030104 developmental biologyLoamSoil waterEnvironmental sciencePinus pinasterSoil horizonAnimal Science and Zoology010606 plant biology & botany
researchProduct

Pedotransfer functions for estimating soil water retention curve of Sicilian soils

2019

Pedotransfer functions (PTFs) make use of routinely surveyed soil data to estimate soil properties but their application to soils different from those used for their development can yield inaccurate estimates. This investigation aimed at evaluating the water retention prediction accuracy of eight existing PTFs using a database of 217 Sicilian soils exploring 11 USDA textural classes. PTFs performance was assessed by root mean square differences (RMSD) and average differences (AD) between estimated and measured data. Extended Nonlinear Regression (ENR) technique was adopted to recalibrate or develop four new PTFs and Wind’s evaporation method was applied to validate the effectiveness of the …

0106 biological sciencesYield (engineering)EvaporationSoil ScienceSoil scienceParametric pedotransfer functionwater retention model04 agricultural and veterinary sciences01 natural sciencesPedotransfer functionpedotransfer functions recalibrationextended nonlinear regression techniqueSoil water040103 agronomy & agriculture0401 agriculture forestry and fisheriesEnvironmental scienceSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-ForestaliSoil propertiesAgronomy and Crop Scienceevaporation method010606 plant biology & botany
researchProduct

Epidemiological analysis of human fascioliasis in northeastern Punjab, Pakistan.

2016

A coprological study was performed to assess human fascioliasis in 7200 subjects inhabiting rural communities of localities close to the capital city of Lahore in the northeastern part of the very highly populated Punjab province, Pakistan, a country where human infection had never been reported before 2005. The analysis of 1200 subjects including 50 subjects/month throughout a two-year study in each of six localities surveyed provided an overall prevalence of 1.18%, with a range between 0.67% and 1.75% according to localities. Infection rates did not differ according to gender, excepting a higher rate in females (1.13% vs 0.77%) in one locality. Prevalences according to age groups proved t…

0301 basic medicineAdultMalemedicine.medical_specialtyFascioliasisAdolescentRange (biology)Veterinary (miscellaneous)Climate Change030231 tropical medicinePopulation densitylaw.invention03 medical and health sciencesFecesYoung Adult0302 clinical medicinelawEnvironmental protectionTropical climateEpidemiologymedicinePrevalenceAnimalsHumansPakistanChildPan evaporationPopulation DensityTropical ClimatePublic healthInfant030108 mycology & parasitologyInfectious DiseasesGeographyTransmission (mechanics)Human fascioliasisInsect ScienceChild PreschoolParasitologyFemaleSeasonsDemographyActa tropica
researchProduct

Biological and chemical characterization of new isolated halophilic microorganisms from saltern ponds of Trapani, Sicily

2021

Abstract Halophilic microorganisms inhabiting hypersaline environments such as salt lakes, Dead Sea, or salt evaporation ponds, have acquired specific cell adaptation to grow within stressful conditions. In this study, we isolated heterotrophic and autotrophic microorganisms from several saltern ponds located at the Natural Reserve “Saline di Trapani e Paceco”, Sicily, Italy. The aim of the study was to investigate the biotechnological potential of new microbial strains from saltern ponds, by capturing their biological and chemical diversity. After the isolation and identification of the sampled strains, their growth capacity was determined under low and high salinity conditions. The metabo…

0301 basic medicineSettore ING-IND/25 - Impianti ChimiciMicroorganism030106 microbiologyHeterotrophEctoinePhotosynthesisEvaporation pondSalinity03 medical and health scienceschemistry.chemical_compound030104 developmental biologychemistrySettore AGR/20 - ZoocoltureBotanyFucoxanthin14. Life underwaterAutotrophBioassay Carotenoids Halophiles Metabolomics Oxiglutathione Saltern pondsAgronomy and Crop ScienceAlgal Research
researchProduct

Influence d'humidité de l'air sur le séchage d'une goutte déposée sur une surface solide et sur la destruction microbienne.

2017

International audience; This study was carried out in order to develop experimental methodology using a camera to monitor the evolution of the surface of a liquid droplet deposited on a solid surface composed of polypropylene. The droplet was exposed to various ambient relative humidity conditions (11.3%, 43.2%, 68.9% and 75.5%). Two types of liquid were investigated: distilled water and water containing nutritive substances (salmon “juice”). At 11.3% relative humidity, it takes 40% longer to evaporate a water droplet (initial weight 0.36 g, volume 360 μL, radius 6.5 × 10−3 m) than a salmon “juice” droplet (3.66 h for distilled water, 2.83 h for salmon “juice”). In the case of the distilled…

0301 basic medicineSimple equation030106 microbiologyDrying rateEvaporationAnalytical chemistryEvaporationBacterial growthDroplet03 medical and health scienceschemistry.chemical_compound[SDV.IDA]Life Sciences [q-bio]/Food engineeringRelative humidityPolypropyleneChemistryAir humidity[ SDV.IDA ] Life Sciences [q-bio]/Food engineeringEnvironmental engineeringRelative humidityListeria monocytogenes030104 developmental biologyVolume (thermodynamics)Distilled water13. Climate action[SDE]Environmental SciencesFood Science
researchProduct

Towards large‐scale steady‐state enhanced nuclear magnetization with in situ detection

2021

Magnetic resonance in chemistry 59(12), 1208 - 1215 (2021). doi:10.1002/mrc.5161

540 Chemistry and allied sciencesMagnetic Resonance Spectroscopy530 PhysicsEvaporation010402 general chemistrySpin isomers of hydrogen01 natural sciences530Catalysischemistry.chemical_compoundMagnetizationGeneral Materials Scienceddc:530Hyperpolarization (physics)Steady stateSpectrometer010405 organic chemistryGeneral Chemistry530 PhysikMagnetic Resonance Imaging0104 chemical sciencesIMeschemistryChemical physics540 ChemieYield (chemistry)
researchProduct