Search results for "Event"

showing 10 items of 4065 documents

Mood profile of an America's Cup team: relationship with muscle damage and injuries.

2010

Purpose: To describe the mood profile of an America’s Cup sailing team during competition and to evaluate the influence of previous injuries occurrence and intensity of physical work on the boat upon mood state. Relationships between mood domains and metabolic markers of muscle damage were also investigated. Methods: A descriptive study was conducted on an America’s Cup yachting race crew comprising 21 male sailors (mean T SD; age = 27.6 T 8.5 yr, weight = 89.3 T 24.9 kg, BMI = 26.5 T 6.9 kgImj2). All measurements were collected during the Louis Vuitton Cup 2007 in Valencia, Spain. The POMS test and creatine kinase (CK) serum activity were measured and correlated. Sailors were grouped accor…

AdultMalemedicine.medical_specialtyWorkEpidemiologyCumulative Trauma Disordersmedia_common.quotation_subjectPhysical ExertionPoison controlPhysical Therapy Sports Therapy and RehabilitationPhysical exerciseMuscle damageAngerAngerYoung AdultInjury preventionmedicineBrief Psychiatric Rating ScaleHumansOrthopedics and Sports MedicineConfusionMuscle SkeletalExerciseDepression (differential diagnoses)Shipsmedia_commonPsychology in Sportbiologybusiness.industryDepressionMood DisordersPreventionMoodMuscle FatiguePhysical therapybiology.proteinCreatine kinasebusinessSportsMedicine and science in sports and exercise
researchProduct

Long-term effects on adult attachment in German occupation children born after World War II in comparison with a birth-cohort-matched representative …

2016

Children born of war are a phenomenon of every conflict. At the end of World War II and thereafter, approximately 400,000 children were fathered by foreign soldiers and born to local women in Germany. Quantitative research on psychosocial consequences of growing up as German occupation child (GOC) has been missing so far.This study examines adult attachment and its association with current depression in GOC (N = 146) using self-report instruments: Adult Attachment Scale, Patient Health Questionnaire. Data were compared to a birth-cohort-matched representative sample of the German population (BCMS; N = 786).GOC differ in both attachment dimensions (less comfortable with closeness/intimacy, l…

AdultMalemedicine.medical_specialtyWorld War IIPopulationPsychological Techniques050109 social psychologyGermanLife Change Events03 medical and health sciences0302 clinical medicineGermanymedicineHumans0501 psychology and cognitive sciencesPsychiatryeducationChildObject Attachmenteducation.field_of_studyPovertyDepression05 social sciencesWorld War IIObject Attachmentlanguage.human_language030227 psychiatryPatient Health QuestionnairePsychiatry and Mental healthAdult Survivors of Child Adverse EventslanguageLife course approachFemaleGeriatrics and GerontologyPshychiatric Mental HealthPsychologyGerontologyPsychosocialAgingmental health
researchProduct

Surgical Treatment of Extravasation Injuries

2005

The authors present their experience of treating anti-cancer drug extravasation by means of a composite surgical technique that consists of infiltration with physiological solution and hyaluronidase and subsequent manual aspiration of solutes alternated with profuse irrigation of the infiltrated area. In the immediate post-op we carry out a medical therapy that consists of calciparine and topic antibiotic and/or steroid creams. Since the year 2000 this technique has been used on 25 patients. We have had neither complications nor scars. Copyright 2005 Wiley-Liss, Inc Surgical treatment of extravasation injuries. Napoli P, Corradino B, Badalamenti G, Tripoli M, Vieni S, Furfaro MF, Cordova A,…

AdultMalemedicine.medical_specialtyantiblastictreatment KeyWords Plus:ANTITUMOR AGENTSextravasation injury; antiblastic; prevention; treatmentANTITUMOR AGENTS; APPROPRIATE MANAGEMENT; TISSUE EXTRAVASATION; HYALURONIDASE [Author Keywords]Drug ExtravasationTherapeutic irrigationScarsAntineoplastic AgentsTISSUE EXTRAVASATIONAPPROPRIATE MANAGEMENTCicatrixpreventionBiopsymedicineHumansCalciparineAuthor Keywords:extravasation injurySurgical treatmentTherapeutic IrrigationAgedRetrospective Studiesmedicine.diagnostic_testbusiness.industryBiopsy NeedleGeneral MedicineHYALURONIDASEMiddle Agedmedicine.diseaseHandExtravasationSurgeryAnti-Bacterial Agentsanticancer drugsTreatment OutcomeOncologyAnesthesiaSurgeryFemalemedicine.symptombusinessInfiltration (medical)Extravasation of Diagnostic and Therapeutic Materials
researchProduct

Behavioral and event-related potential distraction effects with regularly occurring auditory deviants

2007

When auditory stimulation contains infrequent task-irrelevant changes (deviants), behavioral responses to task-relevant aspects of the stimulation are prolonged. Event-related brain potentials (ERPs) show that deviants elicit mismatch negativity (MMN), P3a, and reorienting negativity (RON). Here, we examine whether distraction effects can also be elicited within fixed auditory sequences with deviant probabilities of 0.25, 0.33, and 0.5. Deviants varied either in pitch, loudness, or sound source location. In all conditions MMN and P3a were elicited, suggesting that an automatic detection of and an attentional allocation to the change occurred. With relative frequencies of 25% and 33%, devian…

AdultMalemedicine.medical_specialtygenetic structuresCognitive NeuroscienceeducationMismatch negativityExperimental and Cognitive PsychologyStimulationAudiologyElectroencephalographybehavioral disciplines and activitiesLoudnessP3aDevelopmental NeuroscienceEvent-related potentialDistractionmental disordersReaction TimemedicineHumansAuditory systemBiological PsychiatryBehaviormedicine.diagnostic_testEndocrine and Autonomic SystemsGeneral NeuroscienceElectroencephalographyNeuropsychology and Physiological Psychologymedicine.anatomical_structureAcoustic StimulationNeurologyEvoked Potentials AuditoryPsychologySocial psychologypsychological phenomena and processesPsychophysiology
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Economic evaluation of prolonged and enhanced ECG Holter monitoring in acute ischemic stroke patients

2019

Objective: Atrial fibrillation (AF) is a major cause for recurrent stroke, has severe impact on a patient's health and imposes a high economic burden for society. Current guidelines recommend 24 h ECG monitoring (standard-of-care, SoC) to detect AF after stroke to reduce the risk of future events. However, paroxysmal AF (PAF) is difficult to detect within this period as it occurs infrequently and unpredictably. In a randomized controlled trial (Find-AF(RANDOMISED)), prolonged and enhanced Holter ECG monitoring (EPM) revealed a significantly higher detection rate of AF compared to SoC, although its cost-effectiveness has not yet been investigated. Methods: Based on the data of FIND-AF(RANDOM…

AdultMalemedicine.medical_specialtymacromolecular substancesCOST-EFFECTIVENESS ANALYSIS030204 cardiovascular system & hematologyGUIDELINESTHERAPYBrain Ischemia03 medical and health sciences0302 clinical medicineRecurrent strokeInternal medicinemedicineMANAGEMENTHumanscardiovascular diseases030212 general & internal medicinequality-adjusted life yearsAcute ischemic strokeStrokeAgedAged 80 and overbusiness.industrycost-benefit analysisAtrial fibrillationGeneral MedicineCost-effectiveness analysisMiddle AgedWirtschaftswissenschaftenmedicine.diseaseAtrial fibrillationstroke3. Good healthQuality-adjusted life yearTRIALSEconomic evaluationATRIAL-FIBRILLATIONCardiologyElectrocardiography AmbulatoryQuality of LifeFemalebusinessHolter monitoringsecondary preventionTASK-FORCE
researchProduct

Mobbing in Schools and Hospitals in Uruguay: Prevalence and Relation to Loss of Status.

2017

In the present study in secondary schools and hospitals in Uruguay ( N = 187), we examined the relationship between feeling the victim of mobbing and a perceived loss of status. Nearly all forms of mobbing were more prevalent among hospital employees than among school employees. Among hospital employees, 40.4%, and among school employees, 23.9% reported being the victim of mobbing at least once a week. Being the victim of mobbing was, in both hospitals and schools, more prevalent among older employees, and in hospitals, among employees who were more highly educated and who had been employed for a longer time. Men and women did not differ in reporting that one was a victim of mobbing, but m…

AdultMalemedicine.medical_specialtymedia_common.quotation_subjecteducationPoison control050109 social psychologyHierarchy SocialSuicide preventionOccupational safety and healthSex Factors0502 economics and businessInjury preventionmedicineHumans0501 psychology and cognitive sciencesPsychiatryApplied Psychologymedia_commonSchools05 social sciencesHuman factors and ergonomicsBullyingsocial sciencesHospital employeesMobbingHospitalsClinical PsychologyFeelingSocial PerceptionUruguayFemalePsychology050203 business & managementDemographyJournal of interpersonal violence
researchProduct

Distinguishing Comorbidity and Successful Management of Adult ADHD

2012

Objective: Given high rates of comorbidity, lack of awareness and global acceptance, and varying guidelines for its management, adult ADHD may be an especially difficult condition to diagnose and treat. The objective of this review was to explore and characterize similarities and differences among comorbidities associated with adult ADHD. Method: A review of the literature over the past 10 years was performed using Ovid. Results: A myriad of comorbid conditions such as impulse-control/personality, anxiety, mood, substance use, learning, and sleep disorders overlap with adult ADHD. Furthermore, a number of such conditions have symptoms that can mimic those of ADHD, including hyperactivity, …

AdultMalemedicine.medical_specialtymedia_common.quotation_subjectmedicine.medical_treatmentPoison controlComorbidityImpulsivitybehavioral disciplines and activitiesSex Factorsmental disordersInjury preventionPrevalenceDevelopmental and Educational PsychologymedicineHumansPersonalityPsychiatrymedia_commonMental Disordersmedicine.diseaseComorbidityStimulantClinical PsychologyMoodAttention Deficit Disorder with HyperactivityAnxietyCentral Nervous System StimulantsFemalemedicine.symptomPsychologyClinical psychologyJournal of Attention Disorders
researchProduct

Residual vein thrombosis to establish duration of anticoagulation after a first episode of deep vein thrombosis: the Duration of Anticoagulation base…

2008

Abstract Residual vein thrombosis (RVT) indicates a prothrombotic state and is useful for evaluating the optimal duration of oral anticoagulant treatment (OAT). Patients with a first episode of deep vein thrombosis, treated with OAT for 3 months, were managed according to RVT findings. Those with RVT were randomized to either stop or continue anticoagulants for 9 additional months, whereas in those without RVT, OAT was stopped. Outcomes were recurrent venous thromboembolism and/or major bleeding. Residual thrombosis was detected in 180 (69.8%) of 258 patients; recurrent events occurred in 27.2% of those who discontinued (25/92; 15.2% person-years) and 19.3% of those who continued OAT (17/88…

AdultMalemedicine.medical_specialtymedicine.drug_classDeep veinImmunologyHemorrhageBiochemistryDrug Administration ScheduleSettore MED/15 - Malattie Del SangueDeep vein thrombosioral anticoagulantSecondary PreventionmedicineHumansAgedUltrasonographyVenous ThrombosisFirst episoderesidual vein thrombosisVascular diseasebusiness.industryAnticoagulantHazard ratioAnticoagulantsCell BiologyHematologyMiddle Agedmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareThrombosisConfidence intervalSurgeryVenous thrombosisTreatment Outcomemedicine.anatomical_structureFemalebusinessBlood
researchProduct

Life goals after brain injury in the light of the dual process approach: empirical evidence and implications for neuropsychological rehabilitation.

2011

Sequelae of acquired brain injury endanger the realisation of important life-goals. Discrepancies arise between the importance attached to a goal and the success in realising it. This study investigates goal discrepancies and their influence on patients' subjective well-being (SWB) in different rehabilitation stages. Life-goals, SWB and daily functioning were assessed in 130 neurological inpatients and 42 outpatients by self-report questionnaires. Both patient groups reported greater discrepancies between importance and success of life-goals than a normative sample of healthy controls. In multiple regression modelling, goal discrepancy predicted SWB in the inpatient sample even when control…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentPoison controlPersonal SatisfactionSeverity of Illness IndexOccupational safety and healthArts and Humanities (miscellaneous)Injury preventionActivities of Daily LivingmedicineHumansSubjective well-beingPsychiatryAcquired brain injuryApplied PsychologyPsychiatric Status Rating ScalesRehabilitationRehabilitationNeuropsychologyHuman factors and ergonomicsMiddle Agedmedicine.diseaseNeuropsychology and Physiological PsychologyBrain InjuriesCase-Control StudiesFemaleSelf ReportPsychologyGoalsClinical psychologyNeuropsychological rehabilitation
researchProduct