Search results for "Expression"

showing 10 items of 5168 documents

Effects of ectopic expression of NGAL on doxorubicin sensitivity.

2012

Neutrophil gelatinase-associated lipocalin (NGAL, a.k.a Lnc2) is a member of the lipocalin family which has diverse roles including stabilizing matrix metalloproteinase-9 from auto-degradation and as siderocalins which are important in the transport of iron. NGAL also has important biological functions involved in immunity and inflammation as well as responses to kidney damage. NGAL expression has also been associated with certain neoplasia and is important in the metastasis of breast cancer. Many advanced cancer patients have elevated levels of NGAL in their urine and it has been proposed that NGAL may be a prognostic indicator for certain cancers (e.g. breast, brain, and others). NGAL exp…

siderocalinColorectal cancerBlotting WesternResistanceBreast NeoplasmsLipocainBiologyLipocalinsiderocalinsMetastasisBreast cancerLcn2Lipocalin-2Proto-Oncogene ProteinsmedicineTumor Cells CulturedHumansDoxorubicinNGALIron transportCell Proliferationdrug resistanceAntibiotics AntineoplasticCancermedicine.diseaseResearch PapersLipocalinsOncologyDocetaxelDrug Resistance NeoplasmDoxorubicinImmunologyCancer researchDoxorubicin; Drug resistance; Iron transport; Lcn2; Lipocalins; MMP-9; NGAL; SiderocalinsEctopic expressionFemalelipocalinMMP-9Colorectal Neoplasmsmedicine.drugAcute-Phase Proteins
researchProduct

Large-scale genotyping identifies 41 new loci associated with breast cancer risk

2013

Journal article Breast cancer is the most common cancer among women. Common variants at 27 loci have been identified as associated with susceptibility to breast cancer, and these account for ~9% of the familial risk of the disease. We report here a meta-analysis of 9 genome-wide association studies, including 10,052 breast cancer cases and 12,575 controls of European ancestry, from which we selected 29,807 SNPs for further genotyping. These SNPs were genotyped in 45,290 cases and 41,880 controls of European ancestry from 41 studies in the Breast Cancer Association Consortium (BCAC). The SNPs were genotyped as part of a collaborative genotyping experiment involving four consortia (Collaborat…

signaling pathwayGenotypingGenotypeSingle-nucleotide polymorphismGenome-wide association studyBreast NeoplasmsconsortiumBiologyBreast Neoplasms; Case-Control Studies; Cooperative Behavior; Female; Gene-Environment Interaction; Genetic Loci; Genome-Wide Association Study; Genotype; Humans; Meta-Analysis as Topic; Polymorphism Single Nucleotide; Risk Factors; Genetic Predisposition to Disease; GeneticsPolymorphism Single NucleotideArticle03 medical and health sciences0302 clinical medicineBreast cancerSDG 3 - Good Health and Well-beingMeta-Analysis as TopicRisk FactorsGenotypecommon variantsexpressionGeneticsmedicineHumansGenetic Predisposition to DiseasePolymorphismCooperative BehaviorgeneGenotypinghormone-related protein030304 developmental biologyGenetic associationGenetics0303 health sciencesBreast cancer susceptibilityCancerSingle Nucleotidemedicine.diseaseconfer susceptibilitysusceptibility loci3. Good health14q24.1 rad51l1TOX3Genetic Loci030220 oncology & carcinogenesisCase-Control Studiesgenome-wide associationFemaleGene-Environment InteractionGenome-Wide Association Study
researchProduct

Maturation of Epidermal Langerhans Cells In Vitro Is Accompanied by Downregulation of 4F2 (CD98) as Determined by Differential Display

1998

Following short-term culture, Langerhans cells mature morphologically and functionally into potent immunostimulatory cells. As regulation of gene expression accompanies this maturation process, it is likely that differentially expressed genes are involved in the maturation events. Using the recently described method of differential display, we generated cDNA expression patterns starting with mRNA of murine epidermal Langerhans cells isolated either directly (fLC) or following 3 d cultivation (cLC). Five hundred putative differentially expressed cDNA fragments were recovered from the gel. For a part of the fragments differential expression was confirmed by dot blot and Southern hybridization…

skinLangerhans cellDNA ComplementaryDown-RegulationFusion Regulatory Protein-1GrowthDermatologyBiologyBiochemistryMiceDownregulation and upregulationAntigens CDComplementary DNAmedicineAnimalsRNA MessengerCloning Moleculardifferential gene expressionGeneMolecular BiologySouthern blotRegulation of gene expressionJNK2Differential displayMice Inbred BALB Cepidermal cellsGene Expression Regulation DevelopmentalCell BiologyMolecular biologyMice Inbred C57BLmedicine.anatomical_structureGenesCell cultureLangerhans CellsAntigens SurfaceCarrier ProteinsSequence AnalysisJournal of Investigative Dermatology
researchProduct

The oxidative capacity of skeletal muscle : effects of genotype, high-fat diet and physical activity

2016

sopeutuminenmitochondrial biogenesisrasvatexerciselihaksetliikuntafysiologiaadaptationhiiretruokavaliotgenotyyppiangiogenesishigh-fat dietgene expressionmetabolinen oireyhtymäfyysinen aktiivisuushapenotto
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

ALS-RELATED FUS PROTEIN IS MISLOCALIZED TO CYTOPLASM AND RECRUITED INTO STRESS GRANULES IN FIBROBLASTS OF ASYMPTOMATIC FUS P525L MUTATION CARRIERS

Symptoms onset in Amyotrophic Lateral Sclerosis (ALS) occur when over 70% of motor neurons is already lost, suggesting a relatively long pre-symptomatic phase. The description of several genes linked to ALS (e.g., SOD1, FUS, TARDP, C9orf72) has now allowed identification of pre-symptomatic carriers. These pre-symptomatic (or even preclinical) carriers can be followed up with the aim to identify the very early clinical disease-related changes or a valuable biomarker. These efforts seem at present the best approach for the implementation of an early symptomatic therapy or for the disease prevention. In this work, we studied the expression of FUS protein in cultured skin fibroblasts from pre-s…

stress granuleshuman fibroblastsFUS P525L carriersSettore MED/26 - NeurologiaALScytoplasmic FUS expressionSettore BIO/09 - Fisiologia
researchProduct

Comparative transcriptomics of albino and warningly‐coloured caterpillars

2021

Abstract Coloration is perhaps one of the most prominent adaptations for survival and reproduction of many taxa. Coloration is of particular importance for aposematic species, which rely on their coloring and patterning acting as a warning signal to deter predators. Most research has focused on the evolution of warning coloration by natural selection. However, little information is available for color mutants of aposematic species, particularly at the genomic level. Here, I compare the transcriptomes of albino mutant caterpillars of the aposematic wood tiger moth (Arctia plantaginis) to those of their full sibs having their distinctive orange‐black warning coloration. The results showed >29…

suojautuminenvaroitusväri0106 biological sciencesZoologyContext (language use)Aposematismmelaniinit010603 evolutionary biology01 natural sciencesPredationMelanin03 medical and health sciencesmedicineaposematismgeeniekspressioArctia plantaginisCaterpillarGeneQH540-549.5Ecology Evolution Behavior and SystematicsOriginal Research030304 developmental biologyNature and Landscape Conservation0303 health sciencesgeenitNatural selectionEcologybiologyfungimedicine.diseasebiology.organism_classificationmelaninalbinismigene expressionAlbinismEcology and Evolution
researchProduct

Suoliston mikrobit ja fyysinen suorituskyky

2021

Suolistoamme asuttava miljardilukuinen mikrobiyhteisö osallistuu fysiologiaamme monin tavoin. Se kykenee esimerkiksi hajottamaan ravinnosta yhdisteitä, joihin omat entsyymimme eivät pure. Poikittaistutkimuksissa on löydetty ihmisen fyysisen suorituskyvyn ja suolistomikrobien välisiä yhteyksiä. Liikunta-aktiivisuus näyttäisi lisäävän tiettyjen terveysvaikutteisten suolistomikrobien määrää. Pitkittäistutkimuksista tekemämme systemoitu katsaus osoittaa, että liikunta vaikuttaa ihmisten suolistomikrobeihin, mutta tulokset ovat ristiriitaisia. Yleisimmin keskikuormittava kestävyysliikunta on aiheuttanut eniten muutoksia suolistossa, mutta tähänastinen tutkimus on painottunut iäkkäisiin, ylipaino…

suorituskykyfysiologiamusic therapyruoansulatussuolistomikrobistoart therapytherapeutic interactionliikuntaprobiootitdance therapybakteeritmikrobistosuolistocreative therapyimmuunijärjestelmäexpressionterveysvaikutuksetterveysfyysinen aktiivisuustreatment methodsfysiologiset vaikutukset
researchProduct

Estimating Stress in Online Meetings by Remote Physiological Signal and Behavioral Features

2022

Work stress impacts people’s daily lives. Their well-being can be improved if the stress is monitored and addressed in time. Attaching physiological sensors are used for such stress monitoring and analysis. Such approach is feasible only when the person is physically presented. Due to the transfer of the life from offline to online, caused by the COVID-19 pandemic, remote stress measurement is of high importance. This study investigated the feasibility of estimating participants’ stress levels based on remote physiological signal features (rPPG) and behavioral features (facial expression and motion) obtained from facial videos recorded during online video meetings. Remote physiological sign…

sykeremote photoplethysmographyhead poseetäseurantakatseenseurantastress estimationstressisykemittaritilmeeteye gazefacial expressionetäkokouksetpsykofysiologiaProceedings of the 2022 ACM International Joint Conference on Pervasive and Ubiquitous Computing
researchProduct

Hysteretic Systems Subjected to Delta Correlated Input

1994

The paper deals with the evaluation of the probabilistic response of a single degree of freedom elastic-perfectly plastic system subjected to a delta correlated input process. The probabilistic characterisation of the response is here obtained by considering the accumulated plastic deformations as a compound homogeneous Poisson process independent of the external input. In this case the former can be considered as an external noise acting on the linear system. A closed form solution is also obtained and the analytic expression is compared with the customary Monte-Carlo method.

symbols.namesakeAnalytical expressionsMathematical analysisLinear systemsymbolsProbabilistic logicProcess (computing)Poisson processExternal noiseClosed-form expressionSingle degree of freedomMathematics
researchProduct