Search results for "Fields"

showing 10 items of 575 documents

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Structure of longitudinal chromomagnetic fields in high energy collisions

2014

We compute expectation values of spatial Wilson loops in the forward light cone of high-energy collisions. We consider ensembles of gauge field configurations generated from a classical Gaussian effective action as well as solutions of high-energy renormalization group evolution with fixed and running coupling. The initial fields correspond to a color field condensate exhibiting domain-like structure over distance scales of order the saturation scale. At later times universal scaling emerges at large distances for all ensembles, with a nontrivial critical exponent. Finally, we compare the results for the Wilson loop to the two-point correlator of magnetic fields.

We compute expectation values of spatial Wilson loops in the forward light cone of high-energy collisions. We consider ensembles of gauge field configurations generated from a classical Gaussian effective action as well as solutions of high-energy renormalization group evolution with fixed and running coupling. The initial like structure over distance scales of oder the saturation scale. At later times universal scaling emerges at large distances for all ensembles with a nontrivial critical exponent. Finally we compare the resulats for the Wilson loop to the two-point correlator of magnetic fields. (C) 2014 The Authors. Published by Elsevier BV This is an open access article under the CC BY licenseNuclear and High Energy PhysicsWilson loopLARGE NUCLEINuclear TheoryField (physics)FOS: Physical sciences114 Physical sciences01 natural sciencesColor-glass condensateRENORMALIZATION-GROUPNuclear Theory (nucl-th)GLUON DISTRIBUTION-FUNCTIONSHigh Energy Physics - Phenomenology (hep-ph)Light cone0103 physical sciencesSCATTERINGGauge theory010306 general physicsSMALL-XEffective actionPhysicsCORRELATORSta114010308 nuclear & particles physicsCOLOR GLASS CONDENSATERenormalization groupEVOLUTIONJIMWLK EQUATIONHigh Energy Physics - PhenomenologySATURATIONQuantum electrodynamicsCritical exponentPhysics Letters B
researchProduct

Magnetized boxes for housing polarized spins in homogeneous fields

2010

Abstract We present novel types of permanently magnetized as well as current powered boxes built from soft-ferromagnetic materials. They provide shielded magnetic fields which are homogeneous within a large fraction of the enclosed volume, thus minimizing size, weight, and costs. For the permanently magnetized solutions, homogenization is achieved either by an optimized distribution of the permanent field sources or by jacketing the field with a soft-ferromagnetic cylindrical shell which is magnetized in parallel to the enclosed field. The latter principle may be applied up to fields of about 0.1 T. With fields of about 1 mT, such boxes are being used for shipping spin-polarized 3 He worldw…

PhysicsNuclear and High Energy PhysicsCondensed matter physicsSpinsBiophysicsMechanicsModels TheoreticalCondensed Matter PhysicsBiochemistryHomogenization (chemistry)Magnetic fieldlaw.inventionMagneticsElectromagnetic FieldsHomogeneouslawShielded cableComputer SimulationSpin LabelsJournal of Magnetic Resonance
researchProduct

Three beta-decaying states in 128In and 130In resolved for the first time using Penning-trap techniques

2020

Isomeric states in 128In and 130In have been studied with the JYFLTRAP Penning trap at the IGISOL facility. By employing state-of-the-art ion manipulation techniques, three different beta-decaying states in 128In and 130In have been separated and their masses measured. JYFLTRAP was also used to select the ions of interest for identification at a post-trap decay spectroscopy station. A new beta-decaying high-spin isomer feeding the isomer in 128Sn has been discovered in 128In at 1797.6(20) keV. Shell-model calculations employing a CD-Bonn potential re-normalized with the perturbative G-matrix approach suggest this new isomer to be a 16⁺ spin-trap isomer. In 130In, the lowest-lying (10⁻) isom…

Nuclear and High Energy PhysicsPenning trapAstronomy & Astrophysics01 natural sciencesIonPhysics Particles & Fieldsbeta-decay spectroscopyIsomersShell model0103 physical sciencesPhysics::Atomic and Molecular ClustersNuclear Experiment010306 general physicsSpectroscopyCouplingPhysicsScience & TechnologyNUCLEI010308 nuclear & particles physicsPhysicsPRECISION MASS-SPECTROMETRYNuclear shell modelR-PROCESSshell modelpenning trapRAMSEY METHODPenning traplcsh:QC1-999Physics NuclearExcited stateBeta (plasma physics)Physical SciencesSHELL-MODELTRANSITION-PROBABILITIESisomersAtomic physicsBeta-decay spectroscopylcsh:PhysicsIon cyclotron resonancePhysics Letters B
researchProduct

Proces starzenia się ludności a możliwości kreowania miejsc pracy i nowych kierunków kształcenia na podstawie badania sytuacji osób starszych, któryc…

2016

Proces starzenia się ludności, który z coraz większym nasileniem obserwujemy w Polsce, wywołuje liczne skutki w sferze społecznej i gospodarczej. Rosnący udział osób starszych w społeczeństwie powoduje konieczność zabezpieczenia ich potrzeb, wśród których na pierwszy plan wysuwają się potrzeby zdrowotne, finansowe, potrzeba wsparcia w życiu codziennym oraz kontaktów międzyludzkich. Przeprowadzone przez autorki badania dotyczące sytuacji osób starszych, których dorosłe dzieci przebywają za granicą pokazały, że stopień zaspokojenia poszczególnych potrzeb jest zróżnicowany w zależności od ich rodzaju, a największe deficyty występują w sferze kontaktów międzyludzkich i aktywnego uczestnictwa w …

kierunki kształceniastarzenie się ludnościfields of studiesworkplacesmiejsca pracyageing of the populationStudia Ekonomiczne. Zeszyty Naukowe Uniwersytetu Ekonomicznego w Katowicach
researchProduct

A Randomized Trial of a Schlemm's Canal Microstent with Phacoemulsification for Reducing Intraocular Pressure in Open-Angle Glaucoma

2014

Purpose To assess the safety and effectiveness of the Hydrus Microstent (Ivantis, Inc, Irvine, CA) with concurrent cataract surgery (CS) for reducing intraocular pressure (IOP) in open-angle glaucoma (OAG). Design Prospective, multicenter, randomized, single-masked, controlled clinical trial. Participants One hundred eyes from 100 patients 21 to 80 years of age with OAG and cataract with IOP of 24 mmHg or less with 4 or fewer hypotensive medications and a washed-out diurnal IOP (DIOP) of 21 to 36 mmHg. Methods On the day of surgery, patients were randomized 1:1 to undergo CS with the microstent or CS alone. Postoperative follow-up was at 1 day, 1 week, and 1, 3, 6, 12, 18, and 24 months. Wa…

MaleIntraocular pressureVisual acuityMinimally invasive glaucoma surgerymedicine.medical_treatmentVisual AcuityGlaucomalaw.inventionRandomized controlled trialLens Implantation Intraocularlaw80 and overMedicineSingle-Blind MethodProspective StudiesProspective cohort studyGlaucoma Drainage ImplantsAged 80 and overIntraocularMedicine (all)Adult; Aged; Aged 80 and over; Antihypertensive Agents; Female; Follow-Up Studies; Glaucoma Open-Angle; Humans; Intraocular Pressure; Lens Implantation Intraocular; Limbus Corneae; Male; Middle Aged; Prospective Studies; Prosthesis Implantation; Single-Blind Method; Tonometry Ocular; Visual Acuity; Visual Fields; Young Adult; Glaucoma Drainage Implants; Phacoemulsification; Stents; Ophthalmology; Medicine (all)Middle AgedOpen-AngleFemaleStentsmedicine.symptomLens ImplantationGlaucoma Open-AngleAdultmedicine.medical_specialtyLimbus CorneaeTonometryProsthesis ImplantationTonometry OcularYoung AdultOphthalmologyOcularHumansAntihypertensive AgentsIntraocular PressureAgedPhacoemulsificationbusiness.industryGlaucomaPhacoemulsificationCataract surgerymedicine.diseaseOphthalmologyVisual FieldsbusinessFollow-Up Studies
researchProduct

El campo mediático-digital y la diferenciación social

2021

La digitalización de la sociedad ha abierto nuevos horizontes de investigación a la disciplina sociológica. Sin embargo, los análisis realizados en los últimos años tienden a dejar en un lugar secundario las referencias clásicas de la sociología. Este trabajo pretende mostrar la viabilidad del análisis de la cultura digital desde la perspectiva de los campos sociales de Pierre Bourdieu. Las herramientas teóricas y metodológicas que proporciona el autor francés pueden ser muy útiles para evitar tanto el utopismo digital como los análisis críticos influidos por perspectivas neomarxistas, centrados mayoritariamente en las formas de explotación económica. La teoría de los campos sociales puede …

cultura hacker050402 sociologydigital capitalSociology and Political Science05 social sciencescampos socialessocial fields050801 communication & media studieshacker culturecapital culturalDigital culturedistinción social0508 media and communications0504 sociologysocial distinctionCultura digital
researchProduct

Shade effects on overseeded bermudagrass athletic fields: II. rooting, species composition, and traction

2019

Shade from athletic stadium structures can be a significant detriment to turfgrass performance. The objective of this study was to determine the effects of shade on rooting and playing surface stability, measured as traction, on overseeded or non-overseeded bermudagrass (Cynodon spp.) turf. An experiment was established in 2013 on a mature bermudagrass [Cynodon dactylon (L.) Pers. cv. Riviera] turf that was either overseeded with perennial ryegrass (Lolium perenne L.) or non-overseeded. Shade structures were installed to create four light level treatments, including 0%, 30%, 60%, or 90% light-reducing shade cloth. The light treatments resulted in average daily light integrals (DLI) of 40.8,…

Agronomymedicine.medical_treatmentmedicineShade Overseeding Bermudagrass Athletic Fields Rooting TractionTraction (orthopedics)BiologyAgronomy and Crop Science
researchProduct

Extremely low frequency electromagnetic fields (ELF-EMFs) induce in vitro angiogenesis process in human endothelial cells.

2008

Effects of extremely low frequency (ELF) electromagnetic fields (EMFs) on activation of angiogenesis were analysed using cultured umbilical human vein endothelial cells (HUVECs). The cultures were exposed to a sinusoidal EMF to intensity of 1 mT, 50 Hz for up to 12 h. EMFs increased the degree of endothelial cell proliferation and tubule formation, coupled by an acceleration in the process of wound healing. Since this process is physiologically accompanied by a large modification in the structural organization of actin and focal adhesions, we analyzed the rearrangement of some cytoskeleton elements demonstrating a major reorganization of the fibres and of the focal adhesion complexes after …

animal structuresCytoskeleton organizationPhysiologyAngiogenesisBiophysicsNeovascularization PhysiologicBiologyRadiation DosageFocal adhesionElectromagnetic FieldsEndothelial cellElectricityHumansRadiology Nuclear Medicine and imagingTherapeutic angiogenesisCytoskeletonCells CulturedEndothelial CellsDose-Response Relationship RadiationGeneral MedicineCell biologyEndothelial stem cellAngiogenesiSignal transductionWound healingExtremely low frequency electromagnetic fieldsBioelectromagnetics
researchProduct

Observation of light-by-light scattering in ultraperipheral Pb+Pb collisions with the ATLAS detector

2019

This Letter describes the observation of the light-by-light scattering process, γγ→γγ, in Pb+Pb collisions at √sNN=5.02  TeV. The analysis is conducted using a data sample corresponding to an integrated luminosity of 1.73  nb−1, collected in November 2018 by the ATLAS experiment at the LHC. Light-by-light scattering candidates are selected in events with two photons produced exclusively, each with transverse energy EγT>3  GeV and pseudorapidity |ηγ|<2.4, diphoton invariant mass above 6 GeV, and small diphoton transverse momentum and acoplanarity. After applying all selection criteria, 59 candidate events are observed for a background expectation of 12±3 events. The observed excess of events…

Photonheavy ion: scatteringmass spectrum: (2photon)Physics::Instrumentation and Detectorsmeasured [channel cross section]General Physics and Astronomytransverse energy [photon]nucl-ex01 natural sciencesLight scatteringHigh Energy Physics - ExperimentHigh Energy Physics - Experiment (hep-ex)Scattering processPseudorapidities[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]Invariant massCollisionsNuclear Experiment (nucl-ex)Nuclear ExperimentNuclear Experimentelastic scattering [photon photon]Physicsphoton: transverse energyproton–proton collisionsLarge Hadron ColliderSettore FIS/01 - Fisica SperimentaleATLAS:Mathematics and natural scienses: 400::Physics: 430::Nuclear and elementary particle physics: 431 [VDP]CERN LHC CollPseudorapidityTransverse momentalight-by-light scatteringLHCchannel cross section: measuredParticle Physics - Experimentrelativistic heavy-ion collisionsjets(2photon) [mass spectrum]Transverse energyCiências Naturais::Ciências Físicas530 PhysicsAstrophysics::High Energy Astrophysical Phenomena:Ciências Físicas [Ciências Naturais]FOS: Physical sciencesATLAS experimentddc:500.2LHC ATLAS High Energy Physicstransverse momentumplanarity[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]Relativistic heavy ions530AcoplanarityNuclear physicsscattering [heavy ion]Delbrück scattering0103 physical sciencesStandard deviationNuclear Physics - Experimentddc:5305020 GeV-cms/nucleonSelection criteria010306 general physicsperipheralCiencias Exactastwo-photon [mass spectrum]Integrated luminosityleadScience & Technologyhep-exrapidity [photon]Scatteringbackground:Matematikk og naturvitenskap: 400::Fysikk: 430::Kjerne- og elementærpartikkelfysikk: 431 [VDP]Físicaphoton: rapidityElementary Particles and FieldsHigh Energy Physics::Experimentphoton photon: elastic scatteringmass spectrum: two-photonexperimental results
researchProduct