Search results for "Focusing"

showing 10 items of 95 documents

Optimum Design and Performance of an Electron Gun for a Ka-Band TWT

2019

This paper deals with optimum design and development of a thermionic electron gun to meet specified beam requirements within defined electric and geometric constraints for a Ka -band traveling wave tube (TWT) for space applications. The electron gun design is based on the Pierce method and carried out according to the iterative process indicated by Vaughan. The design of a periodic permanent magnet (PPM) beam focusing system for the stability of the beam is also required. A sensitivity analysis, by varying electric parameters and geometric parameters, is presented and taken into account as a fundamental role to the aim of optimizing the design of the Pierce gun. A cathode current value of 5…

010302 applied physicsBeam diameterMaterials sciencebusiness.industryTraveling-wave tubeSettore ING-INF/01 - Elettronica01 natural sciencesCathodeElectronic Optical and Magnetic Materialslaw.inventionSettore ING-IND/31 - ElettrotecnicaOpticslawcontrol grid electron gun PPM focusing system sensitivity analysis shadow grid TWTMagnet0103 physical sciencesKa bandElectrical and Electronic EngineeringbusinessBeam (structure)VoltageElectron gunIEEE Transactions on Electron Devices
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Ultrasonic phased array inspection of a Wire + Arc Additive Manufactured (WAAM) sample with intentionally embedded defects

2019

In this study, Wire + Arc Additive Manufacture (WAAM) was employed to manufacture a steel specimen with intentionally embedded defects which were subsequently used for calibration of an ultrasonic phased array system and defect sizing. An ABB robot was combined with the Cold Metal Transfer (CMT) Gas Metal Arc (GMA) process to deposit 20 layers of mild steel. Tungsten-carbide balls (ø1-3 mm) were intentionally embedded inside the additive structure after the 4th, 8th, 12th and 18th layers to serve as ultrasonic reflectors, simulating defects within the WAAM sample. An ultrasonic phased array system, consisting of a 5 MHz 64 Element phased array transducer, was used to inspect the WAAM sample…

0209 industrial biotechnologyIntentionally embedded defects Total focusing method (TFM) Ultrasonic phased array Wire + Arc Additive Manufacture (WAAM)Materials sciencePhased arrayAcousticsTKUltrasonic testingBiomedical EngineeringProcess (computing)02 engineering and technology021001 nanoscience & nanotechnologySample (graphics)Industrial and Manufacturing EngineeringSettore ING-IND/14 - Progettazione Meccanica E Costruzione Di Macchinechemistry.chemical_compound020901 industrial engineering & automationchemistryTungsten carbideCalibrationGeneral Materials ScienceUltrasonic sensor0210 nano-technologyMetal transferEngineering (miscellaneous)
researchProduct

A simple method to estimate the isoelectric point of modified Tomato bushy stunt virus (TBSV) particles

2017

We present a simple method to estimate the isoelectric point (pI) of Tomato Bushy Stunt particles. We demonstrate that the combination of agarose gels with different pH buffers can be used to electrophorese the virus particles and their migration patterns can be compared. This method allows us to estimate the pI of the virus particles (wild type, wt, and genetically modified particles) and to monitor the effect of the pI of modified peptide side chains of the viral capsid subunit on the pI of the whole virus particle.

0301 basic medicineTombusvirusSurface PropertiesvirusesClinical BiochemistryBuffersBiologyBiochemistryVirusAnalytical ChemistryDiffusionTombusvirus03 medical and health sciencesIsoelectric PointElectrophoresis Agar GelIsoelectric focusingVirionfood and beveragesHydrogen-Ion Concentrationbiology.organism_classificationMolecular biologyElectrophoresis030104 developmental biologyIsoelectric pointCapsidBiophysicsParticleCapsid ProteinsPeptidesTomato bushy stunt virusELECTROPHORESIS
researchProduct

Hacia la ley europea del clima: las evaluaciones científicas y el futuro papel de las respuestas jurídicas de los estados miembros

2021

Los problemas climáticos son temas persistentes y omnipresentes dentro de las políticas y legislaciones contemporáneas, que exigen un enfoque interdisciplinario para promover soluciones jurídicas adecuadas para la complejidad del tema. Paradójicamente, las propagandas negacionistas, lejos de bloquear las acciones climáticas, las han propiciado, lo que ha llevado al establecimiento de un organismo científico super partes que reconociese las cuestiones climáticas a través de informes científicos avanzados: el Grupo Intergubernamental de Expertos sobre el Cambio Climático de la ONU (IPCC). Desde entonces, muchos países han usado los hallazgos del IPCC como base científica para desarrollar polí…

:CIENCIAS JURÍDICAS [UNESCO]Cambio Climático; Ley Europea del Clima; Pacto Verde Europeo IPCC; Derecho Público Comparadoas well as on the role that EU Members States? legislations will play in facing climate issues. Cambio climáticoIPCC2070-8157 22082 Revista Boliviana de Derecho 584568 2021 32 8055237 Hacia la ley europea del clima las evaluaciones científicas y el futuro papel de las respuestas jurídicas de los estados miembros ViolaEuropean Climate Lawinstead of blocking climate actionsleading to the establishment of a super partes scientific body that has acknowledged climate issues through the most advanced scientific reports: the UN Intergovernmental Panel on Climate Change (IPCC). Since thenPublic Comparative Law. 758 773demanding an interdisciplinary approach to foster legal solutions suitable for the complexity of the subject. Paradoxicallyhave fostered themEU Green DealPasquale Climate issues are persistent and pervasive topics within contemporary policies and legislationsmany countries have adopted the findings of the IPCC as scientific basis for developing strategic policies and legislation with the aim of combining adaptation and mitigation efforts. To this extentmainly focusing on the IPCC scientific basis and the proposed EU regulation related to climate changePacto Verde Europeo IPCCUNESCO::CIENCIAS JURÍDICASPacto Verde EuropeoCambio ClimáticoDerecho Público Comparadothe EU Green Deal and the future European Climate Law exemplify such contemporary attitude. This essay analyses the aforementioned assumptionsClimate changeLey Europea del Climanegationist claimsthe UN Intergovernmental Panel on Climate Change (IPCC). Since then [leading to the establishment of a super partes scientific body that has acknowledged climate issues through the most advanced scientific reports]
researchProduct

Characterization and Tuning of Ultra High Gradient Permanent Magnet Quadrupoles

2009

The application of quadrupole devices with high field gradients and small apertures requires precise control over higher order multipole field components. We present a new scheme for performance control and tuning, which allows the illumination of most of the quadrupole device aperture because of the reduction of higher order field components. Consequently, the size of the aperture can be minimized to match the beam size achieving field gradients of up to $500\text{ }\text{ }\mathrm{T}\text{ }{\mathrm{m}}^{\ensuremath{-}1}$ at good imaging quality. The characterization method based on a Hall probe measurement and a Fourier analysis was confirmed using the high quality electron beam at the M…

Accelerator Physics (physics.acc-ph)electron beamNuclear and High Energy PhysicsPhysics - Instrumentation and DetectorscompactmagneticlensPhysics and Astronomy (miscellaneous)Field (physics)AperturemultipoleFOS: Physical sciencespermanenthalbachx-felNuclear magnetic resonancetuningquadrupolelcsh:Nuclear and particle physics. Atomic energy. RadioactivityQuadrupole magnetMicrotronPhysicsOrder (ring theory)Surfaces and InterfacesInstrumentation and Detectors (physics.ins-det)beam focusingComputational physicsMagnetQuadrupolelcsh:QC770-798Physics::Accelerator PhysicsPhysics - Accelerator PhysicsMultipole expansion
researchProduct

Contra la patologización intensiva en términos de derechos humanos: Activismo gordo en Argentina

2020

This work addresses the way in which Argentine Fat Activism has developed, in recent years, the demand for depathologization of fatness, taking elements from critical discourses on the health of fat people to frame them in a perspective typical of the Human Rights. First, the contemporary fat body is described in terms of stigma and discrimination, especially in the health field. Then, they refer to a series of critical positions on the pathologization and medicalization of fatness from the biomedical perspective, Fat Studies and Fat Activism. Lastly, a series of interventions that the Argentine activist collective Taller Hacer la Vista Gorda produced between 2017 and 2020 were considered, …

Activismo gordo en Argentina Contrera [1137-7038 8537 Arxius de sociologia 562372 2020 42 7674040 Contra la patologización intensiva en términos de derechos humanos]in recent yearsDespatologización.Human RightsFat Studiesespecially in the health field. Thenthe contemporary fat body is described in terms of stigma and discriminationthey refer to a series of critical positions on the pathologization and medicalization of fatness from the biomedical perspectivea series of interventions that the Argentine activist collective Taller Hacer la Vista Gorda produced between 2017 and 2020 were consideredCOVID-19:SOCIOLOGÍA [UNESCO]and highlights the innovation of the local turn in the current context of pandemic. Estudios Sobre GorduraActivismo Gordo1137-7038 8537 Arxius de sociologia 562372 2020 42 7674040 Contra la patologización intensiva en términos de derechos humanos: Activismo gordo en Argentina ContreraDerechos HumanosDepathologization 175 188focusing on the claim of depathologizationUNESCO::SOCIOLOGÍAFat Studies and Fat Activism. Lastlythe demand for depathologization of fatnesstaking elements from critical discourses on the health of fat people to frame them in a perspective typical of the Human Rights. FirstFat ActivismLaura This work addresses the way in which Argentine Fat Activism has developed
researchProduct

Analysis of tear proteins by one- and two-dimensional thin-layer iosoelectric focusing, sodium dodecyl sulfate electrophoresis and lectin blotting. D…

1998

· Background: Isoelectric focusing (IEF) of tear proteins has not yet been carried out in a satisfactory way. Two-dimensional (2D) electrophoresis, especially in the combination of IEF with SDS, is able to differentiate between proteins in detail. The purpose of this study was therefore to analyze tear proteins by 1D IEF alone and in combination with a 2D pattern, and by IEF followed by lectin staining. · Methods: Ampholines, covering a broad range from pH 3 to pH 10, were applied. After IEF, semi-dry blotting and incubation with a group II lectin and two group V lectins was performed. · Results: Tear proteins could be separated into 31 single bands. Tear-specific pre-albumin (TSPA), lactof…

AdolescentImmunoblottingCellular and Molecular Neurosciencechemistry.chemical_compoundSurface-Active AgentsLectinsHumansElectrophoresis Gel Two-DimensionalSodium dodecyl sulfateCystatin CEye Proteinschemistry.chemical_classificationbiologyLactoferrinIsoelectric focusingTransferrinLectinSodium Dodecyl SulfateCerebrospinal Fluid ProteinsCystatinsSensory SystemsOphthalmologyLactoferrinIsoelectric pointchemistryBiochemistryTransferrinImmunoglobulin GTearsImmunoglobulin A Secretorybiology.proteinFemaleMuramidaseCystatinLysozymeIsoelectric FocusingGraefe's archive for clinical and experimental ophthalmology = Albrecht von Graefes Archiv fur klinische und experimentelle Ophthalmologie
researchProduct

Human liver cytosolic epoxide hydrolases.

1988

Human liver epoxide hydrolases were characterized by several criteria and a cytosolic cis-stilbene oxide hydrolase (cEHcso) was purified to apparent homogeneity. Styrene oxide and five phenylmethyloxiranes were tested as substrates for human liver epoxide hydrolases. With microsomes activity was highest with trans-2-methylstyrene oxide, followed by styrene 7, 8-oxide, cis-2-With methylstyrene oxide, cis-1,2-dimethylstyrene oxide, trans-1, 2-dimethylstyrene oxide and 2, 2-dimethylstyrene oxide. With cytosol the same order was obtained for the first three substrates, whereas activity with 2, 2-dimethylstyrene oxide was higher than with cis-1,2-dimethylstyrene oxide and no hydrolysis occurred …

AdultBiochemistryStyreneSubstrate Specificitychemistry.chemical_compoundCytosolStyrene oxideHydrolaseAnimalsHumansEpoxide hydrolaseEpoxide HydrolasesImmunochemistryChromatography Ion ExchangeRatsIsoelectric pointchemistryBiochemistryLiverMicrosomal epoxide hydrolaseEpoxide HydrolasesMicrosomeChromatography GelMicrosomes LiverEpoxy CompoundsElectrophoresis Polyacrylamide GelIsoelectric FocusingEuropean journal of biochemistry
researchProduct

Polymorphism of the Complement C8A and -B Genes in Two Families with C8β Deficiency and Neisserial Infections

1994

Serum samples from members of two Italian families with complement C8 beta deficiency were studied by SDS-PAGE under nonreducing conditions and by IEF. The proband of family I had suffered from two episodes of purulent meningitis and two of her uncles had suffered from only one episode, while the proband of family II had suffered from three different episodes. In contrast to previous findings, where C8 beta deficiency was cosegregating with C8A (alpha-gamma) allotype A, the proband of family II had the C8A allotype B. In addition, in one of her sons a novel variant of the C8 beta chain was detected. Studies at the DNA level in family I, using a recently described PCR system, demonstrate the…

AdultMaleProbandTaqINeisseriaceae InfectionsBlotting WesternImmunologyBiologyPolymerase Chain ReactionPathology and Forensic MedicineExonchemistry.chemical_compoundHumansImmunology and AllergyAlleleComplement ActivationGeneGeneticsPolymorphism GeneticComplement C8Stop codonAllotypePedigreeRestriction sitechemistryElectrophoresis Polyacrylamide GelFemaleIsoelectric FocusingNeisseriaClinical Immunology and Immunopathology
researchProduct