Search results for "Gene expression."

showing 10 items of 4076 documents

Rho GTPases in human breast tumours: expression and mutation analyses and correlation with clinical parameters

2002

In the present study, we addressed the question of a putative relevance of Rho proteins in tumour progression by analysing their expression on protein and mRNA level in breast tumours. We show that the level of RhoA, RhoB, Rac1 and Cdc42 protein is largely enhanced in all tumour samples analysed (n=15) as compared to normal tissues originating from the same individual. The same is true for 32P-ADP-ribosylation of Rho proteins which is catalysed by Clostridium botulinum exoenzyme C3. Also the amount of Rho-GDI and ERK2 as well as the level of overall 32P-GTP binding acvitity was tumour-specific elevated, yet to a lower extent than Rho proteins. Although the amount of Rho proteins was enhance…

rac1 GTP-Binding Proteinrho GTP-Binding ProteinsCancer ResearchRHOAProliferation indexRHOBBlotting WesternDNA Mutational AnalysisRhoCGene ExpressionBreast NeoplasmsRAC1breast tumoursCDC42Polymerase Chain ReactionRho GTPasesRhoB GTP-Binding ProteinHumansBreastRNA Messengercdc42 GTP-Binding ProteinrhoB GTP-Binding Proteinmutation analysisADP Ribose TransferasesMitogen-Activated Protein Kinase 1biologyGenetics and GenomicsMolecular biologyOncologyCdc42 GTP-Binding ProteinMutationtumour progressionDisease Progressionbiology.proteinFemaleGuanosine TriphosphaterhoA GTP-Binding ProteinBritish Journal of Cancer
researchProduct

Enterobacter cloacae administration induces hepatic damage and subcutaneous fat accumulation in high-fat diet fed mice.

2018

Accumulating evidence indicates that gut microbiota plays a significant role in obesity, insulin resistance and associated liver disorders. Family Enterobacteriaceae and especially Enterobacter cloacae strain B29 have been previously linked to obesity and hepatic damage. The underlying mechanisms, however, remain unclear. Therefore, we comprehensively examined the effects of E. cloacae subsp. cloacae (ATCC® 13047™) administration on host metabolism of mice fed with high-fat diet (HFD). C57BL/6N mice were randomly divided into HFD control, chow control, and E. cloacae treatment groups. The E. cloacae treatment group received live bacterial cells in PBS intragastrically twice a week, every ot…

rasvahapotPathology and Laboratory Medicinerasvat (orgaaniset yhdisteet)ruokavaliotBiochemistryMiceAnimal CellsFibrosislcsh:ScienceImmune ResponseConnective Tissue CellsChemical Reactionsta3141ta3142Lipids3. Good healthPhysical sciencesAdiponectinCellular Typesmedicine.medical_specialtyfatsLipolysisImmunologySubcutaneous FatrasvakudoksetMonomers (Chemistry)glycerolDiet High-Fatta311103 medical and health sciencesSigns and SymptomsEnterobacter cloacaeLipolysisPolymer chemistrylcsh:RBiology and Life SciencesHypertrophymedicine.diseaseReceptor InsulinMice Inbred C57BLBiological Tissue030104 developmental biologyEndocrinologylihavuuslcsh:QGlycerol0301 basic medicinePhysiologyLiver cytologysuolistomikrobistolcsh:MedicineAdipose tissueGut floraMedicine and Health SciencesAdipocytesenterobakteerit2. Zero hungerrasvatMultidisciplinarygastrointestinal microbiotatulehdusbiologyHydrolysisadipose tissueChemistryPhysiological ParametersLiverConnective Tissueembryonic structuresFemaleAnatomymedicine.symptomResearch Articleanimal structuresadipocytesInflammationInsulin resistanceEnterobacteriaceaeDiagnostic MedicineInternal medicinemedicineAnimalsObesityTriglyceridesNutritionurogenital systembusiness.industryBody WeightCell Biologybiology.organism_classificationDietToll-Like Receptor 5Gene Expression RegulationinflammationlipolysisdietbusinessEnterobacter cloacaePLoS ONE
researchProduct

Inhibition of small G proteins of the Rho family by statins orClostridium difficiletoxin B enhances cytokine-mediated induction of NO synthase II

2000

In order to investigate the involvement of Ras and/or Rho proteins in the induction of the inducible isoform of nitric oxide synthase (NOS II) we used HMG-CoA reductase inhibitors (statins) and Clostridium difficile toxin B (TcdB) as pharmacological tools. Statins indirectly inhibit small G proteins by preventing their essential farnesylation (Ras) and/or geranylgeranylation (Rho). In contrast, TcdB is a glucosyltransferase and inactivates Rho-proteins directly. Human A549/8- and DLD-1 cells as well as murine 3T3 fibroblasts were preincubated for 18 h with statins (1–100 μM) or TcdB (0.01–10 ng ml−1). Then NOS II expression was induced by cytokines. NOS II mRNA was measured after 4–8 h by R…

rho GTP-Binding ProteinsG proteinBacterial ToxinsMevalonic AcidNitric Oxide Synthase Type IISmall G ProteinClostridium difficile toxin BBiologyGene Expression Regulation EnzymologicMiceGeranylgeranylationBacterial ProteinsPolyisoprenyl PhosphatesPrenylationGTP-Binding ProteinsGene expressionAtorvastatinTumor Cells CulturedAnimalsHumansDrug InteractionsPyrrolesLovastatinPromoter Regions GeneticPharmacology3T3 CellsTransfectionMolecular biologyHeptanoic AcidsEnzyme InductionPapersCytokinesHydroxymethylglutaryl-CoA Reductase InhibitorsNitric Oxide SynthaseSignal transductionBritish Journal of Pharmacology
researchProduct

Lovastatin inhibits Rho-regulated expression of E-selectin by TNFalpha and attenuates tumor cell adhesion.

2003

E-selectin mediated cell-cell adhesion plays an important role in inflammatory processes and extravasation of tumor cells. Tumor necrosis factor-alpha (TNF-alpha) induces E-selectin gene and protein expression in primary human endothelial cells (HUVEC) and in an endothelial cell line (EA.hy-926). As shown by ELISA and FACS analyses, HMG-CoA reductase inhibitors (e.g., lovastatin) impair the TNF-alpha stimulated increase in E-selectin protein expression. Similar results were obtained for E-selectin mRNA expression and promoter activity, indicating that the effect of lovastatin is based on inhibition of gene expression. The effective inhibitory concentration of lovastatin was in a physiologic…

rho GTP-Binding ProteinsRHOATranscription GeneticRHOBAntineoplastic AgentsBiochemistryCell MovementCell Line TumorNeoplasmsGene expressionE-selectinGeneticsmedicineCell AdhesionHumansLovastatinCell adhesionMolecular BiologyCells CulturedbiologyTumor Necrosis Factor-alphaCell biologybiology.proteinCancer researchTumor necrosis factor alphaLovastatinEndothelium VascularSignal transductionE-SelectinBiotechnologymedicine.drugSignal TransductionFASEB journal : official publication of the Federation of American Societies for Experimental Biology
researchProduct

The Paracentrotus lividus metallothionein gene family: structure and expression.

2014

Metallothioneins are metal binding proteins that play a pivotal role in metal homeostasis and detoxification. Since their initial discovery, they have been extensively studied in a variety of organisms ranging from microbes to plants and animals. Organisms often possess multiple genes encoding metallothionein homologs with distinct properties, such as varying affinities for different metals, and in many cases different functions. Despite the plethora of available studies, very little information is known about sea urchin P. lividus MT (1, 2). We previously identified five Pl-MT embryonic cDNAs and we studied their induction after cadmium treatment (3). Now we studied their expression during…

sea urchin development metal response gene expressionSettore BIO/11 - Biologia Molecolare
researchProduct

Chromatin dynamics during sea urchin embryogenesis: effects on the neural alpha tubulin PlTa2 gene expression

2011

Expression of PlTa2 gene during sea urchin P. lividus development, is spatially confined to the neural territory and temporally activated from the blastula stage. To evaluate a possible involvement of chromatin modifications in regulation of PlTa2 gene expression we first searched for DNaseI hypersentive sites. We found four sites localized in the introns of the gene, when we used chromatin extracted from embryos at gastrula stage but not from morula stage. This result suggests a possible functional role of the introns in the activation of the expression of PlTa2 gene. Moreover, we used specific antibodies for RNA polymerase II and for different modified form of lysine 9, lysine 27 and lysi…

sea urchin gene expression chromatin tubulinSettore BIO/11 - Biologia Molecolare
researchProduct

Bcl-xL as a Modulator of Senescence and Aging

2021

Many features of aging result from the incapacity of cells to adapt to stress conditions. When cells are overwhelmed by stress, they can undergo senescence to avoid unrestricted growth of damaged cells. Recent findings have proven that cellular senescence is more than that. A specific grade of senescence promotes embryo development, tissue remodeling and wound healing. However, constant stresses and a weakening immune system can lead to senescence chronicity with aging. The accumulation of senescent cells is directly related to tissue dysfunction and age-related pathologies. Centenarians, the most aged individuals, should accumulate senescent cells and suffer from their deleterious effects,…

senescenceReviewmedicine.disease_causelcsh:Chemistry0302 clinical medicineImmunologic Surveillancelcsh:QH301-705.5SpectroscopyCellular Senescenceimmunosenescence0303 health sciencesapoptosisGeneral MedicineImmunosenescenceComputer Science ApplicationsCell biologyOrgan Specificity030220 oncology & carcinogenesisDisease SusceptibilitycentenariansProtein BindingSignal TransductionSenescencebcl-X ProteinBcl-xLBiologyCatalysisInorganic Chemistry03 medical and health sciencesImmune systemStress PhysiologicalmedicineAnimalsHumansPhysical and Theoretical ChemistrySenolyticMolecular Biology030304 developmental biologyBcl-xLOrganic ChemistryIntrinsic apoptosisagingGene Expression Regulationlcsh:Biology (General)lcsh:QD1-999senolyticsbiology.proteinWound healingOxidative stressBiomarkersDNA DamageInternational Journal of Molecular Sciences
researchProduct

Maturation of Epidermal Langerhans Cells In Vitro Is Accompanied by Downregulation of 4F2 (CD98) as Determined by Differential Display

1998

Following short-term culture, Langerhans cells mature morphologically and functionally into potent immunostimulatory cells. As regulation of gene expression accompanies this maturation process, it is likely that differentially expressed genes are involved in the maturation events. Using the recently described method of differential display, we generated cDNA expression patterns starting with mRNA of murine epidermal Langerhans cells isolated either directly (fLC) or following 3 d cultivation (cLC). Five hundred putative differentially expressed cDNA fragments were recovered from the gel. For a part of the fragments differential expression was confirmed by dot blot and Southern hybridization…

skinLangerhans cellDNA ComplementaryDown-RegulationFusion Regulatory Protein-1GrowthDermatologyBiologyBiochemistryMiceDownregulation and upregulationAntigens CDComplementary DNAmedicineAnimalsRNA MessengerCloning Moleculardifferential gene expressionGeneMolecular BiologySouthern blotRegulation of gene expressionJNK2Differential displayMice Inbred BALB Cepidermal cellsGene Expression Regulation DevelopmentalCell BiologyMolecular biologyMice Inbred C57BLmedicine.anatomical_structureGenesCell cultureLangerhans CellsAntigens SurfaceCarrier ProteinsSequence AnalysisJournal of Investigative Dermatology
researchProduct

The oxidative capacity of skeletal muscle : effects of genotype, high-fat diet and physical activity

2016

sopeutuminenmitochondrial biogenesisrasvatexerciselihaksetliikuntafysiologiaadaptationhiiretruokavaliotgenotyyppiangiogenesishigh-fat dietgene expressionmetabolinen oireyhtymäfyysinen aktiivisuushapenotto
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct