Search results for "Gestational"

showing 10 items of 352 documents

Expression of the α4 isoform of the nicotinic acetylcholine receptor in the fetal human cerebral cortex

2001

Nicotinic acetylcholine receptors are likely to play an important role in neuronal migration during development. Furthermore, the alpha4 receptor subunit gene is related to a hereditary juvenile form of epilepsy. Only little information is available, however, on the expression of cerebrocortical nicotinic acetylcholine receptors during human fetal development. Using non-isotopic in situ hybridization and immunohistochemistry, we have studied the distribution of the alpha4 subunit of the nicotinic acetylcholine receptor mRNA and protein in the human frontal cortex at middle (17-24 weeks of gestation) and late (34-42 weeks of gestation) fetal stages. Both, alpha4 receptor mRNA and alpha4 rece…

Malemedicine.medical_specialtyXenopusGestational AgeReceptors NicotinicBiologyGanglion type nicotinic receptorDevelopmental NeuroscienceInternal medicineMuscarinic acetylcholine receptormedicineMuscarinic acetylcholine receptor M4AnimalsHumansRNA MessengerIn Situ HybridizationAcetylcholine receptorCerebral CortexGene Expression Regulation DevelopmentalImmunohistochemistryNicotinic acetylcholine receptorNicotinic agonistEndocrinologyOocytesFemaleAlpha-4 beta-2 nicotinic receptorAcetylcholineDevelopmental Biologymedicine.drugDevelopmental Brain Research
researchProduct

Delayed neonatal visual evoked potentials are associated to asymmetric growth pattern in twins

2020

Abstract Objectives To study the association between intrauterine growth and visual pathways maturation by neonatal visual evoked potentials (VEPs) in twins, in view of a possible prognostic role. Methods Seventy-four twin neonates from 37 pregnancies were selected based on gestational age of more than 30 weeks and uneventful perinatal clinical course. Flash VEPs were recorded at the same postmenstrual age in each twin pair. The association between P2 latency and anthropometric variables at birth was analyzed by comparison within each twin pair and regarding each variable as ordered difference between the two twins. Results Analysis of differences within each twin pair highlighted that inte…

Malemedicine.medical_specialtygenetic structuresTwinsSocio-culturaleVisual system050105 experimental psychologyFetal DevelopmentCorrelation03 medical and health sciencesChild Development0302 clinical medicinePhysiology (medical)Internal medicinemedicineHumansVisual Pathways0501 psychology and cognitive sciencesLatency (engineering)Visual evoked potential latencyPonderal IndexBody mass indexVisual Cortexbusiness.industry05 social sciencesInfant NewbornPostmenstrual AgeTwinGestational ageElectroencephalographyIntrauterine growthAnthropometryAsymmetric growthBody mass index; Intrauterine growth; Ponderal Index; Twins; Visual evoked potential latencySensory SystemsNeurologyCardiologyEvoked Potentials VisualFemaleNeurology (clinical)businessBody mass index030217 neurology & neurosurgeryClinical Neurophysiology
researchProduct

Congenital \textittoxoplasma infection: monthly prenatal screening decreases transmission rate and improves clinical outcome at age 3 years

2013

Background. Toxoplasma infection during pregnancy exposes the fetus to risks of congenital infection and sequelae that depend heavily on gestational age (GA) at time of infection. Accurate risk estimates by GA are necessary to counsel parents and improve clinical decisions. Methods. We analyzed data from pregnant women diagnosed with acute Toxoplasma infection in Lyon (France) from 1987 to 2008 and assessed how the risks of congenital toxoplasmosis and of clinical signs at age 3 years vary depending on GA at the time of maternal infection. Results. Among 2048 mother-infant pairs, 93.2% of mothers received prenatal treatment and 513 (24.7%) fetuses were infected. Because of a significant red…

Microbiology (medical)AdultMalemedicine.medical_specialtyAdolescent[SDV]Life Sciences [q-bio]030231 tropical medicinePrenatal diagnosisPrenatal careToxoplasmosis CongenitalCohort Studies03 medical and health sciencesYoung Adult0302 clinical medicinePregnancyPrenatal DiagnosismedicineHumansYoung adultPregnancy Complications Infectious0303 health sciencesPregnancy030306 microbiologybusiness.industryObstetricsInfant NewbornGestational ageInfantMiddle Agedmedicine.diseaseToxoplasmosisInfectious Disease Transmission Vertical3. Good healthInfectious DiseasesChild PreschoolGestationFemaleFrancebusinessToxoplasmosisCohort study
researchProduct

Is it possible to predict late antepartum stillbirth by means of cerebroplacental ratio and maternal characteristics?

2019

Objective: To examine the potential value of fetal ultrasound and maternal characteristics in the prediction of antepartum stillbirth after 32 weeks’ gestation. Methods: This was a retrospective multicenter study in Spain. In 29 pregnancies, umbilical artery pulsatility index (UA PI), middle cerebral artery pulsatility index (MCA PI), cerebroplacental ratio (CPR), estimated fetal weight (EFW), and maternal characteristics were recorded within 15 days prior to a stillbirth. The values of UA PI, MCA PI, and CPR were converted into multiples of the normal median (MoM) for gestational age and the EFW was expressed as percentile according to a Spanish reference range for gestational age. Data fr…

Middle Cerebral Arterymedicine.medical_specialtyFetal middle cerebral artery DopplerCerebroplacental ratioGestational AgeUmbilical artery dopplerUltrasonography PrenatalUmbilical Arteries03 medical and health sciencesFetal hemodynamics0302 clinical medicinePregnancyUmbilical artery DopplermedicineHumans030212 general & internal medicinereproductive and urinary physiologyRetrospective StudiesFetus030219 obstetrics & reproductive medicineObstetricsbusiness.industryFetal growth restrictionUltrasoundObstetrics and GynecologyStillbirthfemale genital diseases and pregnancy complicationsbody regionsSpainPulsatile FlowAntepartum stillbirthembryonic structuresPediatrics Perinatology and Child Healthpopulation characteristicsFemalebusinessValue (mathematics)The Journal of Maternal-Fetal & Neonatal Medicine
researchProduct

Reading and math abilities of Finnish school beginners born very preterm or with very low birth weight

2017

Reading and math skills of preterm born (birth weight 1500 g or gestational age:532 weeks) children and full term (FT) children were compared during the first weeks of grade 1. The participants were 194 preterm born and 175 FT children born between 2001 and 2006. There were more precocious readers among FT than among preterm students, but even the latter performed close to the national norm. FT and preterm group differences among non-readers were minor with only rapid naming showing a robust difference. Math performance showed a stable difference in favor of FT students and the difference was sustained in the full-scale IQcontrol. Major brain pathology increased the likelihood of poor schol…

NEUROBEHAVIORAL OUTCOMESSocial Psychology515 PsychologyBirth weightNEUROPSYCHOLOGICAL OUTCOMESeducationVery low birth weightAcademic achievement3124 Neurology and psychiatryEducationDevelopmental psychology03 medical and health sciencesPREREADING SKILLS0302 clinical medicine3123 Gynaecology and paediatrics030225 pediatricsACADEMIC-ACHIEVEMENTDevelopmental and Educational PsychologymedicineCognitive developmentVery Preterm Birthta516AUTOMATIZED NAMING RANta5154. Educationta118405 social sciences3112 Neurosciences050301 educationGestational agepreterm birthbirth weightLEARNING-DISABILITIESLow birth weightmath skillsCOGNITIVE-DEVELOPMENTLearning disabilityRISK-FACTORSGestationreading skillsschool readinessmedicine.symptomFOLLOW-UPPsychologyCHILDREN BORN0503 educationVery preterm birthLearning and Individual Differences
researchProduct

Anomalous alterations affecting microglia in the central nervous system of a fetus at 12 weeks of gestation: case report.

2003

We report here on the first documented case of profound alterations specifically affecting the microglial population within the nervous system during the fetal period. This case, derived at gestational week 12, was one amongst a series of second trimester brains currently being investigated with respect to microglial colonization of the human fetal brain. No significant pathological alterations could be identified upon gross macroscopy or following microscopic analysis of serial brain sections stained with cresyl fast violet (Nissl). By contrast, sections stained immunohistochemically to detect MHC class II (CR3/43) and CD68 (PG-M1) antigens revealed a marked pathological change in the morp…

Nervous systemCentral Nervous SystemPathologymedicine.medical_specialtyCentral nervous systemThalamusPopulationAntigens Differentiation MyelomonocyticGestational AgeBiologyPathology and Forensic MedicineMajor Histocompatibility ComplexCellular and Molecular Neurosciencesymbols.namesakeEmbryonic and Fetal DevelopmentFetusAntigens CDPregnancymedicineHumanseducationFetuseducation.field_of_studyMicrogliaStaining and LabelingCerebrumImmunohistochemistrymedicine.anatomical_structureNissl bodysymbolsFemaleNeurology (clinical)MicrogliaActa neuropathologica
researchProduct

Monoclonal antibodies SMI 311 and SMI 312 as tools to investigate the maturation of nerve cells and axonal patterns in human fetal brain

1998

Neurofilaments, which are exclusively found in nerve cells, are one of the earliest recognizable features of the maturing nervous system. The differential distribution of neurofilament proteins in varying degrees of phosphorylation within a neuron provides the possibility of selectively demonstrating either somata and dendrites or axons. Non-phosphorylated neurofilaments typical of somata and dendrites can be visualized with the aid of monoclonal antibody SMI 311, whereas antibody SMI 312 is directed against highly phosphorylated axonal epitopes of neurofilaments. The maturation of neuronal types, the development of area-specific axonal networks, and the gradients of maturation can thus be …

Nervous systemHistologyNeurofilamentmedicine.drug_classeducationImmunocytochemistryGolgi ApparatusGestational AgeBiologyMonoclonal antibodyPathology and Forensic MedicineEpitopeschemistry.chemical_compoundNeurofilament ProteinsmedicineHumansParaformaldehydeNeuronsPyramidal CellsfungiInfant NewbornAntibodies MonoclonalBrainAbortion InducedDendritesCell BiologyImmunohistochemistryAxonsmedicine.anatomical_structurenervous systemchemistryImmunohistochemistryNeuronNeuroscienceImmunostainingCell and Tissue Research
researchProduct

A Smartphone App to Promote Healthy Weight Gain, Diet, and Physical Activity During Pregnancy (HealthyMoms): Protocol for a Randomized Controlled Tri…

2019

BACKGROUND: Excessive gestational weight gain is common and associated with adverse outcomes both in the short and long term. Although traditional lifestyle-based interventions have shown to mitigate excess gestational weight gain, little is known about whether mobile Health (mHealth) apps can promote healthy weight gain, diet, and physical activity during pregnancy. OBJECTIVE: The primary aim of the HealthyMoms trial is to determine the effectiveness of a smartphone app (HealthyMoms) for mitigating excess gestational weight gain during pregnancy. Secondary aims are to determine the effectiveness of the app on dietary habits, physical activity, body fatness, and glycemia during pregnancy. M…

Original Papermobile phoneNutrition and DieteticsexercisekuntoliikuntaraskaussmartphonepainonhallintatelelääketiedeNäringsläragestational weight gainmobiilisovelluksettelemedicinepregnancyteleterveydenhuoltodietJMIR Research Protocols
researchProduct

Unpredicted ovulations and conceptions during early pregnancy: an explanatory mechanism of human superfetation

2012

In this bioessay, a literature review on human superfetation was performed in order to find epidemiological variables associated with this phenomenon. Thereafter, an explanatory mechanism of superfetation compatible with the endocrinological, histological and physiological changes undergone by women during early pregnancy is proposed. Superfetation can be defined as the ovulation, fertilisation and implantation of a second or additional embryo(s) during pregnancy. The literature review evidences a small discordance in gestational age between dizygotic twins in humans (range: 2–4 weeks; mean ± s.e.m.: 3.3 ± 0.3 weeks). This difference is compatible with a luteal out-of-phase (LOOP; i.e. atyp…

Ovulationmedia_common.quotation_subjectTwinsPhysiologyGestational AgeSuperfetationReproductive technologyLuteal PhaseLuteal phaseBiologyEndocrinologyOvarian FolliclePregnancyDeciduaTwins DizygoticGeneticsmedicineHumansEmbryo ImplantationSuperfetationMolecular BiologyOvulationmedia_commonPregnancyEstradiolGestational ageAnatomymedicine.diseaseDecidual reactionmedicine.anatomical_structureReproductive MedicineFertilizationFemaleAnimal Science and ZoologyPregnancy MultipleDevelopmental BiologyBiotechnologyFallopian tubeReproduction, Fertility and Development
researchProduct

Air pollution, residential greenness and metabolic dysfunction during early pregnancy in the infancia y medio ambiente (Inma) cohort

2021

Despite extensive study, the role of air pollution in gestational diabetes remains unclear, and there is limited evidence of the beneficial impact of residential greenness on metabolic dysfunction during pregnancy. We used data from mothers in the Spanish INfancia y Medio Ambiente (INMA) Project from 2003–2008. We obtained spatiotemporally resolved estimates of fine particulate matter (PM2.5) and nitrogen dioxide (NO2) exposures in early pregnancy and estimated residential greenness using satellite-based Normal Difference Vegetation Index (NDVI) within 100, 300 and 500 m buffers surrounding the mother’s residence. We applied logistic regression models to evaluate associations between each o…

PM<sub>2.5</sub>GDMHealth Toxicology and MutagenesisAir pollutionEarly pregnancy factor010501 environmental sciencesLogistic regressionmedicine.disease_causeNO201 natural sciences0302 clinical medicinePregnancy030212 general & internal medicineGeneral Environmental ScienceAir PollutantsbiologyRRegression analysis3. Good healthGestational diabetesCohortMedicineFemalegestational diabetesresidential greennesNitrogen DioxidePM2.5High cholesterolArticleOddslipids03 medical and health sciencesSDG 3 - Good Health and Well-beingEnvironmental healthNO<sub>2</sub>Air PollutionmedicineHumans0105 earth and related environmental sciencesPregnancybusiness.industryPublic Health Environmental and Occupational HealthEnvironmental Exposuremedicine.disease13. Climate actionresidential greennessbiology.proteinGeneral Earth and Planetary SciencesParticulate MatterbusinessInternational Journal of Environmental Research and Public Health
researchProduct