Search results for "Housing"

showing 10 items of 345 documents

Pricing the homebuyer's countryside view

2008

In most developed nations big cities are expanding ever farther into the countryside. Rural populations are growing, whether with workers - commuters or the self-employed - retired people, or temporary residents. In France a "periurbanization" movement began in Ile-de-France in the 1960s and spread to the large provincial cities in the next decade before becoming a nationwide phenomenon (Le Jeannic 1997; Schmitt et al. 1998; Cavailhès and Schmitt 2002). So successful was this movement that by 1999 33% of the land area of France was periurban with 12.3 million people living there. Progression from 1990 to 1999 was remarkable, with the area concerned increasing by half (more than 6 million he…

[SHS.GEO] Humanities and Social Sciences/Geographyhedonic damagesHEDONIC PRICES[SHS.GEO]Humanities and Social Sciences/GeographyGEOGRAPHICAL AND ECONOMIC MODELSComputingMilieux_MISCELLANEOUShousing[SHS]Humanities and Social Sciences[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Exploring Associations of Housing, Relocation, and Active and Healthy Aging in Sweden : Protocol for a Prospective Longitudinal Mixed Methods Study

2021

Background: While housing and neighborhood features have the potential to impact opportunities for active aging, there is a lack of knowledge related to how older people reason regarding their housing situation and how housing and fulfillment of relocation are associated with active and healthy aging. Objective: The objectives of Prospective RELOC-AGE are to study housing choices and relocation and explore effects on active and healthy aging among men and women aged 55 years and older in Sweden considering relocation. Methods: The estimated sample (2800) will include people aged 55 years and older being listed for relocation at either of two housing companies: a local public housing company…

aging-in-placeactivityasuinympäristöasuminenpitkittäistutkimusmobilitykotona asuminenaccessibilityikääntyminenvanhuspalvelutlife-spaceliikuntakykyhousing preferencesparticipationesteettömyys ja saavutettavuusmoving expectationsikääntyneetage-friendly housingneighborhood
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

La rajola a la costa i els residus a l’interior. Mapa dels conflictes socioecològics al País Valencià

2020

EnglishIn the last decade, the Valencian Country has experimented a growth of the productive processes that has led to an unprecedented degradation of the territory. At the same time, the increase in the ecological, material and carbon footprint has led to the generation of socio-ecological conflicts. A typology of socio-ecological conflicts is proposed, consisting of 5 categories —derived from urban processes, infrastructures, pollution and public health, the extraction of mineral resources and the use of water resources—, which classifies and places them on the 'map of the socio-ecological conflicts of the Valencia Country'. The map locates such environmental conflicts. Furthermore, the u…

biologyPaís ValenciàHousing constructionbiology.organism_classificationValencianlanguage.human_languageGeographic distributionTypologyGeographyTipologialanguageMapMapaConflictes socioecològicsHumanitiesValenciaSocio-ecological conflictsValencian Country
researchProduct

Gir boplikt lavere boligpriser?

2020

Siden 1974 har norske kommuner hatt adgang til å innføre boplikt for eiendommer som er eller har vært i bruk som helårsbolig. Ordningen har helt siden den ble innført, vært svært omstridt. Vi undersøker hvordan boplikt påvirker boligprisene. Geografisk avgrenser vi oss til kystkommuner på Sørlandet, der mange som har sin faste bopel andre steder i landet, etterspør fritidsbolig. Uten boplikt kan helårsboliger bli kjøpt opp for å bli brukt som fritidsboliger. Den empiriske analysen, basert på data fra fire sørlandskommuner, hvorav den største kommunen, Arendal, opphevet boplikten i 2014, viser at prisene i kystsonen økte da boplikten ble opphevet.

boligpriserhousing priceshousingpricesVDP::Samfunnsvitenskap: 200::Økonomi: 210Mechanical EngineeringEconomicsEnergy Engineering and Power Technologyresidencerequirementslcsh:Human settlements. Communitieslcsh:HT51-65Management Science and Operations Researchbopliktresidence requirements
researchProduct

Modular fastening system and tool–holder working unit for incremental forming

2019

Incremental forming can be usually unfolded either on CNC milling machine–tools or serial industrial robots. The approach proposed in this paper tackles the problem of designing a modular fastening system, which can be adapted for both above mentioned technological equipment. The fastening system of the sheet–metal workpiece is composed of a fixing plate and a retaining plate. The fixing and retaining plates will be made up of different individual elements, which can be easily repositioned to obtain different sizes of the part. Moreover, the fastening system has to be able to be positioned either horizontally (to be fitted on CNC milling machines) or vertically (to be fitted on industrial r…

business.industryComputer sciencelcsh:TA1-2040Mechanical engineeringComputerApplications_COMPUTERSINOTHERSYSTEMSTool holderModular designbusinesslcsh:Engineering (General). Civil engineering (General)Unit (housing)MATEC Web of Conferences
researchProduct

Human-Animal Relationships in Supported Housing: Animal Atmospheres for Mental Health Recovery

2021

Being in a relationship with an animal can promote the well-being of people. For many individuals, this usually takes place at home. This study reports about homes for people with mental health problems (with or without co-occurring substance use), who live in supported housing operated by public landlords, entailing tenancies that are usually stricter regarding their pet policies than ordinary homes. We thus addressed the following research questions through ethnographic fieldwork at seven distinct places: which types of human–animal relationships occur in supported housing, and how do they affect the tenants? We analyzed the collected data informed by the Grounded Theory approach and foun…

business.industryPublic housingSocial connectednessmedicine.medical_treatmentAnimal-assisted therapyPublic relationsAffect (psychology)Mental healthethnographySolidarityGrounded theoryBF1-990animalsrecoveryAnimal welfareatmosphereVDP::Samfunnsvitenskap: 200::Psykologi: 260medicinePsychologybusinessPsychologyGeneral Psychologyhuman-animal relationshipmental healthOriginal Research
researchProduct

Shooting down the price: Evidence from Mafia homicides and housing prices

2022

In this paper, we estimate the effect of the homicides by the Camorra, the Neapolitan Mafia, on housing prices in Naples. The study develops on a unique panel data set at the administrative district level for the period 2002–2018 of geo-localized homicides involving innocent victims (denoted as IVH), which are treated as exogenous shocks that negatively affect housing demand. We find that the occurrence of such homicides causes a decrease in housing prices in the range of 2.5–3.8 percentage points. This effect decreases with the distance from an IVH and over time. These results are robust to the utilization of different econometric specifications and to the considerations of possible confou…

camorra housing prices organized crime spatial econometricsorganized crimespatial econometricsGeography Planning and DevelopmentEnvironmental Science (miscellaneous)Settore SECS-P/01 - Economia Politicacamorrahousing price
researchProduct

Formal property rights in the face of the substantial right to housing

2016

This paper explores the dichotomy between formal property rights and use value of rights in the field of the right to housing for homeless people, focusing on the entitlement of the squatting practices to claim the collective rights in the public domain. This collective claim can be considered an alternative to the ‘traditional’ conception of the public property as 'exclusive' domain of State. In the cities of Southern Europe, urban space has become an ‘object’ of contention by groups of inhabitants, who are organized at various levels, and an object of claiming – through illegal (although not illegitimate) forms of occupation of public or social private properties – the right to housing as…

capabilities approach right to housing squattingsquattingcapabilities approachright to housingSettore ICAR/21 - Urbanistica
researchProduct

Nuove relazioni tra tessuto urbano e agricolo nel parco del Gugliotta a Piano Tavola, Carini

2014

To the south-west of Palermo, along the north-east belt of Carini marked by Mount Colombrina and crossed by thestream Gugliotta, a wide area called Piano Tavola stretches between city and countryside. Its margins are given by the suburban volumes standing along corso Italia (west), the olive grove under Pizzo Castellaccio (east), villa Dominici (north-east), the industrial area and the railway (north), and the quarry in Manostalla locality (south-east). It is evident the pressure of the buildings on the olive grove and countryside, the presence of roads that close and isolate the district, and the lack of continuity between open spaces and built areas. The reorganization of the road network…

città in estensione campagna housingSettore ICAR/14 - Composizione Architettonica E Urbana
researchProduct